KEGG   Pseudoalteromonas sp. NC201: PNC201_21265Help
Entry
PNC201_21265      CDS       T05464                                 

Gene name
mutT2
Definition
(GenBank) Putative mutator protein MutT4
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
psen  Pseudoalteromonas sp. NC201
Brite
KEGG Orthology (KO) [BR:psen00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:psen03400]
    PNC201_21265 (mutT2)
Enzymes [BR:psen01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     PNC201_21265 (mutT2)
DNA repair and recombination proteins [BR:psen03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    PNC201_21265 (mutT2)
 Prokaryotic type
    PNC201_21265 (mutT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: AUJ72469
UniProt: A0A2K9K481
LinkDB All DBs
Position
pNC201:803589..803999
Genome map
AA seq 136 aa AA seqDB search
MDQVVRVGVGVVIMHDNKILLGERIGAHGAHTWATPGGHLEYGEDIEACAIREVHEETGL
DVVNVEKLGFTNDYFANEQKHYVTLFVMARCDTHDAEVKEPNKCKQWQWFSLDELPQPLF
LPLVNFLEENNTLYQG
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggatcaagtcgtacgcgtcggggttggcgtggtaataatgcacgataataaaattttg
cttggtgagcgcatcggcgctcatggcgcacatacttgggcaacccctggtggccattta
gagtatggagaggacattgaggcatgcgcgataagagaggtgcatgaagaaacggggcta
gatgttgtaaacgttgaaaagcttggttttactaatgattattttgccaatgagcagaaa
cattatgtcactctgtttgtcatggcaaggtgcgatactcatgatgcagaagttaaagag
ccaaataaatgcaaacaatggcagtggttttcgcttgatgaattgccgcagcccctattt
ttgcctttggtgaactttttagaagaaaacaacacactttatcaaggctaa

DBGET integrated database retrieval system