KEGG   Pseudoalteromonas sp. NC201: PNC201_22325Help
Entry
PNC201_22325      CDS       T05464                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psen  Pseudoalteromonas sp. NC201
Brite
KEGG Orthology (KO) [BR:psen00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PNC201_22325 (ahpF)
Enzymes [BR:psen01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PNC201_22325 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 DAO FAD_oxidored Thi4 FAD_binding_3 Glutaredoxin NAD_binding_7 K_oxygenase NAD_binding_8 Thioredoxin_9 FMO-like Thioredoxin_4 NAD_binding_9 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AUJ72681
UniProt: A0A2K9K7F3
LinkDB All DBs
Position
pNC201:1047118..1048686
Genome map
AA seq 522 aa AA seqDB search
MLDNQIKTQLQSHFSSLQRPIELVITVDDSKKSQELKGLAQDLASLSDKITLSESIEGER
IPQMVVRGVETKSEITFAGVPMGHEFTSLVLALLHSGGHATKASADDLELITNIDNALNF
EVYISLSCQTCPQVVQALNLMAAVNPNITTTMIDGALFQEEVESRNIMAVPTVYLNGEQF
SQGAVSLSDILLKLDSKAGEKQAALLNEKDVFDVLVVGGGPAGASAAIYAARKGLNTGVV
AERFGGQVADTLGIENFISVQKTEGPKLVAQLEEHVNQYGVDVMKNQRAAAINKGETIDI
TLESGAVLRAKSLVLATGARWRSMNVPGETEYKGRGVAYCPHCDGPLFKGKPVAVIGGGN
SGIEAAIDLANIVEHVTVLEFADTLRADEVLIKKAKSLANITIIKNAQTTEVVGDGSKVT
GLNYIDRVSGDAHSLALAGIFVQIGLVPNTEWLKSSEVALSRFGEIEIDSKGATSLAGVY
AAGDATTTPFKQIIIAMGGGATASLGAFDYLIRLGQDDEQAA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttagacaaccaaattaaaactcaactacaaagccattttagctctctacaacgtccg
attgaactcgtcattaccgttgatgacagtaaaaaatcgcaagagctaaaagggttagca
caagacttagcgtcattgagcgacaaaattactttatctgaatcaattgaaggtgaacgt
atcccacaaatggtggtgcgtggtgttgaaacaaagagcgaaattacgtttgctggtgtt
cctatgggacatgagtttaccagtttggtacttgcattattgcattcaggcggtcatgca
actaaagcatcggcagacgatctcgaactgatcacaaatatagataacgcattgaacttt
gaggtttacatctcactgagttgccaaacttgtccgcaagtagtgcaggctttgaatctc
atggcggctgttaacccaaatattaccaccaccatgattgatggtgctttgttccaagaa
gaagtggagtcacgcaacatcatggccgtgccaaccgtgtacttaaatggtgagcaattt
agccaaggcgcagtgagcttaagcgatattttattaaaacttgatagtaaagctggtgaa
aaacaagcagccttacttaacgagaaagacgtgtttgatgtgctcgttgtaggtggcggc
cctgctggtgcttcagctgcaatctatgctgctcgtaaagggttaaatacaggggtagtt
gcggagcgttttggcggccaagttgccgatactttgggtattgagaactttatttcagtg
caaaaaactgaaggtcctaagctggttgcacagttagaagagcatgttaaccagtatggc
gttgatgtgatgaagaaccagcgtgcagcggcaattaacaaaggcgaaaccattgatatc
acgcttgaaagcggtgcggtattaagggccaaatctttagtattggctacaggtgcacga
tggagaagcatgaatgtacccggcgaaaccgagtacaagggtagaggcgtagcatattgt
ccacattgcgatggtccgttatttaaggggaaacctgtcgcggttattggtggcggtaac
tcgggtattgaagcagctatcgacttggcaaatattgttgaacacgtcacggtattagaa
tttgccgatacgcttagagctgacgaagtgctgatcaaaaaggcgaaaagccttgccaac
atcaccattattaaaaacgcacaaaccacagaagtagttggagatggtagtaaagtaacg
ggtcttaattacatagacagggtcagcggtgacgctcattcgttggcactggctggcatt
tttgtacaaattggacttgtaccaaatactgaatggttaaagtcgagtgaagttgcactt
agccgctttggtgaaatcgaaattgacagcaaaggtgcgacaagtctagctggtgtttac
gccgcaggcgatgcaaccaccacaccgtttaagcaaattattattgcgatgggtggagga
gcgacagcaagcttaggcgcttttgattatctaattcggttagggcaagacgacgagcaa
gctgcttaa

DBGET integrated database retrieval system