KEGG   Pseudoalteromonas piratica OCN003: OM33_00320Help
Entry
OM33_00320        CDS       T03513                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pseo  Pseudoalteromonas piratica OCN003
Pathway
pseo00250  Alanine, aspartate and glutamate metabolism
pseo00410  beta-Alanine metabolism
pseo00430  Taurine and hypotaurine metabolism
pseo00650  Butanoate metabolism
pseo01100  Metabolic pathways
pseo01110  Biosynthesis of secondary metabolites
pseo01120  Microbial metabolism in diverse environments
pseo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pseo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    OM33_00320
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OM33_00320
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OM33_00320
   00430 Taurine and hypotaurine metabolism
    OM33_00320
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OM33_00320
Enzymes [BR:pseo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     OM33_00320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 HTH_37 Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AIY63778
UniProt: A0A0A7EBA9
LinkDB All DBs
Position
1:complement(73164..74804)
Genome map
AA seq 546 aa AA seqDB search
MVDETRQAVRPAIASEESLMRIFTVPEAPGSTLAKIEQEISSNLAGFLNENIAAVEKPLH
EIEKDFQSAIIPEEPRFVSEHAQELMEKLVAHSVHTSAPSFIGHMTSALPHFVLPLSKLM
VGLNQNLVKIETSKAFTPLERQVLGMMHHMVYGKDDTFYRKSMHNAKNALGAFCSGGTVA
NISALWVARNKLLKPDGDFTGINSDGLVAAMMHYGYKGLAILVSERGHYSLGKAADVLGI
GRSNIVSIETDENNRVNVAKMREKAKELADKGIKVMAIVGVAGTTETGNIDPLHELADLA
EEIKCHFHIDAAWGGATLLSNNARSLLAGCERADSITIDAHKQMYVPMGAGIVLFKEPDT
VNVVEHHAEYILRKGSKDLGSHTLEGSRPGMAMLVHACLSIIGRKGYEMLIDKSLEKARY
FAELIKQTEDFELVTEPELCLLTYRYVPEKIKEVLKTADEQTKLDIYAALNRFTASMQKR
QREAGRSFVSRTRLTPYQYDNLPTVVFRVVLANPLTSNQILHDILAEQRVLAEKDPIFKK
YLAKYL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggttgatgaaacacgtcaagcagtgcgcccagcgatagcgtctgaagaaagcttaatg
cgaatttttacggtgccagaagcgccgggctcgactttggctaaaattgagcaggaaatt
tcgagtaacctcgctggttttctaaatgaaaacattgccgcggtggaaaaaccactgcat
gagattgaaaaagattttcagtcggcaataattcctgaagaacctcgctttgtttcagaa
catgcgcaagagctgatggaaaagctggttgcacattcggttcatacatcagccccgagc
tttattggtcatatgacatccgcgttaccgcattttgttttacctctgtctaagttgatg
gtggggttaaaccaaaatttggtaaagattgaaacatcaaaagcttttacaccgcttgaa
cgtcaagtactcggtatgatgcatcatatggtttatggtaaagacgataccttttaccgt
aagtcgatgcataatgctaaaaatgcgttaggggcattttgctctggcggcacagttgca
aacatttctgcactttgggttgctcgaaacaagttacttaaacctgatggcgattttacg
ggtattaatagcgatggtttagttgctgcaatgatgcattatggctacaaaggtttagct
attttagtgtctgagcgaggccattactctcttggtaaagcagctgacgttttgggtatt
ggtcgcagtaatatcgtatcgattgaaactgatgaaaacaatcgagtaaatgttgctaaa
atgcgtgaaaaggcgaaagaattggccgataaaggcattaaggtgatggcaatcgttggt
gttgctggaaccactgaaacaggcaatattgacccattacatgaattagctgacttagca
gaggaaattaagtgtcatttccatattgatgctgcttggggtggtgcgacattactctct
aataatgctagaagtttacttgcagggtgtgagcgagcggattcaatcaccatcgatgca
cataaacaaatgtatgtcccaatgggggctggcattgtacttttcaaagagccagacaca
gttaatgtcgttgagcatcatgctgaatatattctacgtaaaggttcaaaagatttaggt
tcgcatacgcttgaaggcagtcgtcctggtatggcgatgctagtgcatgcctgtttatca
attattggtcgtaaaggctatgaaatgttgattgataaaagcctcgaaaaagcccgctat
tttgccgaacttatcaagcaaacagaggactttgagttagttactgagcctgagctttgc
ttgttaacgtatcgctatgtacctgaaaaaattaaagaggtgcttaaaacagctgatgag
caaaccaaactcgatatttacgcagctttaaaccgctttacagcaagtatgcaaaaacga
cagcgtgaagcagggcgctcgtttgtatcacgtacacggttaacgccatatcagtacgat
aatttacccactgtggtatttcgcgttgtgcttgcgaatccgttgacttcaaatcaaatt
ttgcatgatattttggcagagcaacgcgttttagctgagaaagatccgatctttaaaaag
tatttagcaaagtatctttaa

DBGET integrated database retrieval system