KEGG   Pseudoalteromonas piratica OCN003: OM33_00630
Entry
OM33_00630        CDS       T03513                                 

Definition
(GenBank) hypothetical protein
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
pseo  Pseudoalteromonas piratica OCN003
Pathway
pseo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pseo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OM33_00630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pseo01001]
    OM33_00630
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pseo02022]
    OM33_00630
Enzymes [BR:pseo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     OM33_00630
Protein kinases [BR:pseo01001]
 Histidine kinases
  OmpR family
   OM33_00630
Two-component system [BR:pseo02022]
 OmpR family
  RstB-RstA
   OM33_00630
SSDB
Motif
Pfam: HATPase_c HisKA HATPase_c_5 HATPase_c_2 HATPase_c_3 DUF763
Other DBs
NCBI-ProteinID: AIY63837
UniProt: A0A0A7ECS4
LinkDB
Position
1:complement(140409..141923)
AA seq 504 aa
MAISLVLLLTYFVFSEINHHRYQQHLAEQLSGTLYLIKQGIERQKDTADRERWLELVASL
MNVSLSVSSPSKVPNQINISLQQNEQNRYRVSYPINAQQQLDLTLNGVSEHLVTGTAFLL
LNELGLYPAQQRQMIFQSISSEFNYPIHRVSSDSQVLDSEQLERLTRGEMVIIWQTEFDS
SLSFDVFAPWGNSQDLLKLGTINVFEQYPTWLLVSGFAAVLVALALLILLILRLIVNRLT
YIQHKVDAIEPELIEATKMPEHLDVINQLTWKIDQMALRIKRLIAQKHQMFRAVSHDLRT
PLSKAQFRLEALSQIGVDNTLVEQTKADMNQLNLLIGDLLSYEKISESERITKETLELNH
FIMTIVDGMTIVFPKVKFSFEAQNFCVAAINKQLFTRMLENLLNNAARFAESSVVVALSS
NDTTTVLDIIDDGPGVDEKSKAHIFEPFYQQDQSRSANCSGYGLGLAIVKQIVSQHAGEI
ELMATSQGAHFRIRLPNQAEGEES
NT seq 1515 nt   +upstreamnt  +downstreamnt
gtggcaattagcttagtcttgttgctaacttattttgtattttcggagattaaccatcat
cgctatcagcagcatttagctgagcagctttcaggtaccttgtacttaattaagcaaggg
atagaaagacaaaaagataccgcagatcgtgagcgctggcttgaattggtggcgtcttta
atgaacgtctcactgtcggtttcctcgccatcaaaagtgcctaatcaaatcaacatatcc
ttacagcaaaacgagcaaaataggtatcgcgtcagttatccaatcaatgcacaacagcaa
ctcgatttgactttaaatggtgtcagtgagcaccttgttacgggtaccgcatttttattg
ttaaatgagttaggtttgtatcccgcacaacagcgtcaaatgatttttcaatcgattagt
agtgaattcaactacccaattcatcgcgtgagtagcgatagtcaagtactggatagcgaa
cagttagagcgcttaacccgaggtgaaatggttattatatggcaaactgagtttgatagt
agtttgtcgtttgatgtctttgctccttggggaaattcacaagacttacttaaactaggc
acgataaacgttttcgaacagtatccaacgtggttattggtatccggttttgccgctgta
ttggtggcgttggcattattaatcctgctcattcttcgcttgattgtaaatcgattgact
tacattcagcataaggtagatgcgatagaaccggaattaattgaagcaaccaaaatgcca
gaacaccttgatgtgataaatcaattaacctggaaaatagaccaaatggcactgcgcatt
aagcggttaattgcgcaaaagcatcaaatgtttcgtgcagtgtcacatgatttaagaacc
cctttatctaaagcgcagttcagattagaagccctgagtcagattggcgtagataatacg
ctcgttgagcaaacaaaagctgatatgaatcagcttaacttattaattggtgacttactg
agttacgaaaaaatcagtgaaagtgaacgaattacaaaagaaacgttagaacttaaccat
tttattatgacaattgtagatggtatgacaattgttttccctaaggtaaagttttccttt
gaagcccaaaacttctgtgtggcagcgataaataagcagttatttacacgtatgttagaa
aacctattaaataatgccgcccgtttcgcagagtcatctgttgttgtggcgttatcgagt
aacgatacaaccactgtattagatattattgatgacggccccggggtagatgaaaaaagt
aaagcacatatttttgagcctttttatcagcaagatcaaagtcgaagcgctaactgttcg
ggctacggattaggattagcaatcgttaaacaaattgtttcgcaacatgctggtgaaata
gagctgatggcaacctcacaaggcgcccattttcgcatcaggttacccaatcaagcagaa
ggagaagagtcatga

DBGET integrated database retrieval system