KEGG   Pseudoalteromonas piratica OCN003: OM33_03640Help
Entry
OM33_03640        CDS       T03513                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pseo  Pseudoalteromonas piratica OCN003
Brite
KEGG Orthology (KO) [BR:pseo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    OM33_03640
Enzymes [BR:pseo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     OM33_03640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored DAO Thi4 NAD_binding_7 AlaDh_PNT_C FAD_binding_3 NAD_binding_8 K_oxygenase FMO-like Lycopene_cycl NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AIY66274
UniProt: A0A0A7EI01
LinkDB All DBs
Position
1:812251..813816
Genome map
AA seq 521 aa AA seqDB search
MLDNNIKTQLQSHFSSIVDPVELVIALDDSDKSQEVKALAHDLLALSEHFLIREDDSIAR
KPMLSIRSPKRGTEINFAGVPMGHEFTSLILALLHTGGVATKASELEVEQIKGLQSTLNF
EVYISLSCQTCPGVVQALNTIAALNSNVTVTMIDGALFQGEVSERNILAVPSVYLNGELF
SQGALSLSDIINKLDDGAAEKTAELLSQKDKFDVLVVGGGPAGASAAIYAARKGLKTGIV
AERFGGQVADTVGIENFISVQKTEGPKLVAQLEEHVKDYDVDIITQQKAVTLGKSGNVEV
ALESGATLSSKSVILATGARWREMNVPGEQEYRGKGVAYCPHCDGPLFKGKKVAVIGGGN
SGIEAAIDLANIVEHVTVLEFADTLRADEVLIKKANSLGNIEIIKSAQTTEVIGDGTRVT
GLNYTDRASGDEHSLSLAGIFVQIGLIPNTEFLKGSIELTPFGEIVIDDKGATSMPGVYA
AGDATTTPFKQIIIAMGSGATASLGAFDYLIRHADGTQQVA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
attttagataacaatatcaaaacacaattacagagccattttagcagtattgtcgaccct
gtagagctggtcattgccttagatgacagtgataaatcacaggaagtaaaagccttagca
catgatcttttagcgctaagtgagcattttttaattcgtgaagacgattcaattgcacgc
aaaccaatgctttcaattcgttcaccgaaaagaggcaccgaaattaattttgcgggtgtg
ccaatgggccacgaatttacaagcttaattttggcactgttgcatacagggggcgttgct
accaaagcaagtgagctggaggtggaacaaattaagggtttgcaaagtacacttaatttc
gaagtgtatatttcactgagttgccaaacatgcccaggagtagtacaagcgcttaataca
attgcggctttaaattcgaatgttacggttacaatgatcgatggtgcactgttccaaggt
gaagtgtcagagcgcaacattttggccgtaccaagcgtgtatttaaatggtgagctattt
agccaaggtgcactttcactcagtgacattatcaataaacttgatgatggcgcagcagaa
aaaacagccgagctgctgtcacaaaaagataaatttgatgtacttgtagtcggtggtggg
ccagcaggtgcctccgcggcaatttatgcggcgcgtaagggcttaaaaacaggtattgta
gctgagcgctttggtggccaagtggcagatactgttggcattgaaaactttatttcggtg
caaaaaacagaagggcctaagctggtggcacagcttgaagaacatgttaaagactatgat
gttgatattattacccaacaaaaagcggttaccttaggtaagtctggcaacgtagaagtc
gcactggaaagcggtgcaacactgtccagtaaaagtgtgattttggcaacaggagcacgc
tggcgtgaaatgaatgtaccgggcgaacaagaatatcgtggtaaaggtgttgcttactgc
ccgcactgtgatggtccgttatttaaaggcaaaaaagtggcagtgattggtggtggtaac
tcaggcatcgaggccgcgatcgatttagctaatattgttgagcatgttaccgtattggag
tttgctgatacgttacgtgccgatgaagtgctgatcaaaaaggccaacagcctaggtaat
attgaaattattaaaagtgcacaaaccactgaagttatcggtgacggtacacgagtaact
ggcctaaattatacggatcgtgcctctggcgacgaacatagcctttcccttgccggtatt
tttgtgcaaataggcttaattccaaatacagagtttttaaaaggcagtatcgaattaact
ccttttggcgagattgttattgatgacaaaggcgctacatcaatgccaggtgtatatgct
gctggtgatgcgacaaccacaccatttaaacaaattattattgcaatgggcagtggtgca
acagcaagtttaggcgcatttgattatttaattcgccatgctgatggtacgcagcaagta
gcatag

DBGET integrated database retrieval system