KEGG   Pseudoalteromonas piratica OCN003: OM33_08050Help
Entry
OM33_08050        CDS       T03513                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pseo  Pseudoalteromonas piratica OCN003
Pathway
pseo03030  DNA replication
pseo03410  Base excision repair
pseo03420  Nucleotide excision repair
pseo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pseo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    OM33_08050
   03410 Base excision repair
    OM33_08050
   03420 Nucleotide excision repair
    OM33_08050
   03430 Mismatch repair
    OM33_08050
Enzymes [BR:pseo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     OM33_08050
    6.5.1.6  DNA ligase (ATP or NAD+)
     OM33_08050
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     OM33_08050
DNA replication proteins [BR:pseo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    OM33_08050
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     OM33_08050
DNA repair and recombination proteins [BR:pseo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     OM33_08050
   NER (nucleotide excision repair)
    Other NER factors
     OM33_08050
   MMR (mismatch exicision repair)
    Other MMR factors
     OM33_08050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AIY65113
UniProt: A0A0A7EF20
LinkDB All DBs
Position
1:1754408..1755235
Genome map
AA seq 275 aa AA seqDB search
MMALKLLLFFSLIFCFEHTFAVEVQLAKTYQRQGVSEYLVSEKLDGVRAIWRNQQLVTRN
GNKIYAPSWFTKNWPNKWLDGELWSQHNDFEFIASTVLDKKPNQAAWRKIKFFVFDMPDN
ENVFSIRYQNYLAAILETDSDYLAAVEQHQFSDESQLERFYQARLKQGAEGVILHAKQAR
FSNGRSAHLLKYKPYQDAEGIIVGYSAGKGKYQGMVGALIVELKSGEQIKLGSGLSDALR
KKPPVIGSQVTYRYNGFTKYGKPRFARFLRVRQRE
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atcatggctcttaaacttcttttgttcttttctttaattttttgctttgaacatacattt
gccgtagaagttcaactggcaaaaacttatcagagacaaggtgtaagcgagtacttagtt
agcgaaaaactagatggtgtaagagctatttggcgtaatcaacagcttgttacccgtaat
ggaaataaaatttatgcaccgagctggtttactaaaaactggccaaataaatggctcgat
ggagaactatggagtcagcataatgattttgagtttatcgccagtaccgttttagataaa
aaaccgaaccaagcagcttggcgaaaaataaaattttttgtttttgatatgccagataat
gaaaacgtgttttctatccgttatcaaaattacctcgcagcaattcttgagacagactct
gactaccttgcggcagtcgaacaacaccagttcagtgatgaatcgcaattagagcgcttc
taccaagcacgtttaaagcaaggtgctgaaggggttattctacatgcaaaacaggctcga
tttagtaatggacgaagtgctcacttactcaaatataaaccttatcaagacgccgaaggg
atcatagtaggttacagtgccggcaaaggtaaatatcaaggaatggttggtgcgctgatt
gttgagcttaaaagtggtgagcaaataaaacttggcagtggtttatctgatgcgttaaga
aaaaagcccccagttatcggcagtcaagttacttatcgttataatgggtttaccaaatat
ggcaaaccacgatttgcacggtttttacgtgttagacagcgtgaataa

DBGET integrated database retrieval system