KEGG   Pseudoalteromonas piratica OCN003: OM33_09840Help
Entry
OM33_09840        CDS       T03513                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pseo  Pseudoalteromonas piratica OCN003
Pathway
pseo00500  Starch and sucrose metabolism
pseo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pseo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OM33_09840
Enzymes [BR:pseo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     OM33_09840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 DUF3823_C TPR_6
Motif
Other DBs
NCBI-ProteinID: AIY65417
UniProt: A0A0A7EHE6
LinkDB All DBs
Position
1:2115837..2118251
Genome map
AA seq 804 aa AA seqDB search
MFKNKFIKHSLLASAVTLAISGCGSEQPNTKDVNSQASASPAEVAPGAPGNKPYWAYSGK
TGIGTSYEAYVDGAYSNKAVTGDVSTVWFSLAQGIITETMFGLIHQAQLKEMQFVVKGDD
FVATELDDTAWEIDYLQKDSLGRPTSLAYKLVNTDKQGRFKIEKHIFTDSNDQTLFVRVA
LESLNGKPLSLYVHANPYVNNNGVGDSAMVKEGKLIAIDGDNYLTLTANKAFEQTSVGFI
GKSDLISQLSAGNELTSYASTGDKPGNVSLDALLGTTSSKAQFDLTLSFGNTLEKSVASA
ENSQQKGYDQLLKEYGTDWQRYLASLDLESLSTQSADQGRLAYASALVLKAQEDKTHAGA
LIASLSNPWGDTVPAIEGHTGYKAVWVRDFYQVAMAFLAMGDKQTAKTAFEYLEKVQVTN
KTPGNQGDTGWFLQKTHVDGELEWVGVQLDQTAMPIMLGWKLYLADVLTKDELVHWFNKM
LKPAADFLVEGGLAKILWNDTEIKPPFTQQERWEEQAGHSPSTTAAVIAGLITASEIAKL
AGDEALAAKYLTVAKGYNSQVESRMYTTKSTLPSDASNGQHFVRISQDDDANSSTLLGDN
NGRKGLVKQSILDGGFLELVRYGVRSADDKHIIDTLDEYDALNLPENLKVKYNFTFAGVE
GEFPGWRRYGNDGYGEDEVTGTNYAEGGNNTPGQRGRVWPFFTGERGHYEIAKLAQSGQF
DKAKQTNLVNTYVKGMEQFANEGLMLPEQVWDGVGVNPHNYTFGEGTNSATPLAWTHAEY
IKLLRSMSDKQVWDYYPVVKEKLN
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaaataaattcattaagcactcattactagcaagtgctgtaacactggctatt
tcaggttgtggaagtgaacaaccaaataccaaagatgttaattcacaggcttcagcatct
cctgcagaggttgcaccaggcgcaccgggtaacaaaccttattgggcttattcaggcaaa
acgggcattggtaccagctatgaagcgtatgtagacggtgcgtatagtaacaaagctgta
accggtgatgtatcgacagtatggttttcacttgcccaaggtattattaccgaaacgatg
tttggtttaattcaccaagcgcaattaaaagaaatgcaatttgtggtaaaaggtgatgat
tttgtagccaccgaacttgatgatacggcatgggaaattgattacttacaaaaagattca
ctgggtagaccaacgtcattagcatacaaattggtaaatactgacaagcaaggtcgcttt
aaaattgaaaagcatattttcaccgacagcaatgatcaaacactgtttgttcgtgttgct
ttagagtcattaaacggtaaaccgttatcactttacgtacacgccaatccatacgttaat
aacaatggtgttggtgatagtgcaatggtaaaagagggcaaattgattgccattgatggt
gataattatttaacgcttacggcaaacaaagcgtttgagcaaaccagtgttggctttatt
ggtaaatcagatcttatatcacaacttagcgctggtaatgaattaacaagttatgcgtca
acgggtgacaaaccaggtaacgtatcgcttgatgcactgcttggtacaacatcaagtaaa
gctcaatttgatttaacgctatcgtttggtaatacattagaaaaaagtgttgcttctgcg
gaaaatagccaacaaaaaggctatgaccaactactaaaagagtacggtacagactggcag
cgttatttagcatcacttgacctggagtcactgagcacacaatcagctgatcaaggccgt
ttagcatatgccagtgcgttagtattaaaagcacaagaagataaaacccacgcaggtgcc
ttgattgcatcattgtctaacccttggggcgatacagtacccgcaattgaaggccacact
ggatataaagcggtatgggttcgtgatttttatcaagttgcaatggcatttttagccatg
ggtgataaacaaacggccaaaaccgcatttgaatacttagaaaaagtacaagtcacaaac
aaaacaccaggcaaccagggcgatacagggtggttcttacagaaaacgcacgtagatggt
gagcttgagtgggttggtgttcagttagaccaaaccgccatgccaattatgcttggttgg
aagctttaccttgctgatgtactaaccaaagatgaacttgttcactggtttaacaaaatg
cttaaacctgcggcagactttttagtggaaggtggccttgccaaaattttatggaatgat
accgaaatcaaaccaccatttacccagcaggaacgttgggaagaacaagcaggacattct
ccttcaacaactgcagccgtgattgcagggcttatcacagccagtgaaatagcaaagctt
gccggtgatgaagcccttgcagcaaaatacttaacggtagcaaaaggctacaatagccaa
gtcgaatcgcgtatgtacacaacgaaaagtacactaccaagcgatgcatcaaatggtcag
cactttgtgcgcatcagccaagatgacgatgcaaactcatctactttgctaggcgataac
aacggccgaaaaggccttgttaagcaaagcattcttgatggtggttttttagagttggtt
cgttatggggtacgcagtgctgatgataaacacattatcgataccttagatgaatatgat
gcgcttaacttaccggaaaaccttaaagttaaatacaactttacctttgcaggcgttgaa
ggtgaatttcctggctggcgtcgatatggtaatgatggctatggtgaagatgaagtgacg
ggcactaactatgctgaaggtggtaacaatacacctgggcagcgtggacgtgtttggcca
tttttcaccggtgaacgtggtcattatgaaattgccaagctagcgcaatcaggtcagttt
gataaagcaaagcaaacaaacttggtaaacacctatgtaaaaggcatggaacaatttgcc
aacgaaggtttaatgttaccagagcaggtgtgggatggtgttggggttaacccacacaac
tacacatttggtgagggcaccaattctgcaacaccgcttgcgtggactcatgcagagtac
attaaactattgcgctcaatgtctgataagcaagtatgggattactacccagttgtgaaa
gaaaaactaaattaa

DBGET integrated database retrieval system