KEGG   Pseudoalteromonas piratica OCN003: OM33_13355
Entry
OM33_13355        CDS       T03513                                 

Definition
(GenBank) alanyl-tRNA synthetase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
pseo  Pseudoalteromonas piratica OCN003
Pathway
pseo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pseo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    OM33_13355
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pseo01007]
    OM33_13355
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pseo03016]
    OM33_13355
Enzymes [BR:pseo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     OM33_13355
Amino acid related enzymes [BR:pseo01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   OM33_13355
Transfer RNA biogenesis [BR:pseo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    OM33_13355
 Prokaryotic type
    OM33_13355
SSDB
Motif
Pfam: tRNA-synt_2c DHHA1 tRNA_SAD Intein_splicing HMD
Other DBs
NCBI-ProteinID: AIY65991
UniProt: A0A0A7EIV3
LinkDB
Position
1:complement(2886993..2889593)
AA seq 866 aa
MQHMTTAEIRNAFLNYFASEQHQVVPSSSLVPGNDPTLLFTNAGMVQFKDVFLGAERRPY
NRATSSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGNYFKQDAIKFAWQFLTDVI
KLPKDKLLVTVYHTDDEAFDIWHKEMGLAEDKIIRIDTADNFWSMGDTGPCGPCSEIFYD
HGEEIWGGPPGSPEEDGDRFIEIWNLVFMQYNRHADGTMEPLPSQSVDTGMGLERISAIM
QGVHSNYEIDIFQNLIKAAAAVTNAQDLEDKSLRVIADHIRSCAFLIADGVMPSNEGRGY
VLRRIIRRAVRHGNKLGATETFFHKLVAALATEMGEAYPELIKQQSIIEKVLRIEEEQFG
KTLDRGLAILEESLKGLQGDVIPGDLVFKLYDTYGFPADLTADVARERFMTIDERGFQEA
MEVQRKQAQQAGKFGADYNDQLKSEKTTEFKGYDSEQYTGTVVELFSGADAVTVLEDGQQ
GIVILDRTPFYAESGGQVGDTGVLKVANGEFIVEDTTKLGNAFAHKGKVVGRIGVNDRVD
AHVDATRRDNTKKNHTATHLLHEALRVVLGEHVTQKGSLNDPERLRFDFSHFEAVTKEEL
QRIEDMVNLEIRKNIDLNTELMAIDAAKEKGAMALFGEKYDDEVRVVSIGDFSIELCGGT
HVKRTGDIGLFKIVSESGIAAGVRRIEAVTGEGAVAYINKQAETLSAIAALVKGDSNNVL
DKVSALVERAKGLEKEISQLNDKLASAAGASLLDAVIDVNGVKLLVANVEGTESKALRGM
VDDLKNKLGSGIIALGVANGDKVSLIAGVTKDLTGQFKAGELVNHMASQVGGKGGGRPDM
AQAGGSQPENLAAALESVNAWVSERA
NT seq 2601 nt   +upstreamnt  +downstreamnt
atgcagcacatgacgaccgcggaaatccgcaacgcgtttctaaattatttcgcatcagag
caacaccaagtagtgccatcaagttcattggtaccaggtaacgatcctaccttgctattc
accaatgcaggtatggtacagtttaaagatgtatttctaggtgctgagcgccgcccatac
aatcgtgcaacgagttcgcagcgctgtgtacgtgctggtggtaagcacaacgatttagaa
aacgtaggttatactgctcgtcaccacacgttctttgaaatgcttggtaactttagtttt
ggtaactatttcaagcaagatgcgattaaatttgcttggcaattcctcacagacgttatc
aaactgccaaaagataaattacttgtaacggtttatcacacagatgatgaagcgtttgat
atttggcataaagaaatgggacttgcagaggataaaattatccgcatcgacactgctgat
aacttctggtcgatgggtgatacaggtccatgtggtccatgttctgaaatattctacgat
cacggtgaagagatttggggtggtcctccgggcagtcctgaagaagacggtgaccgtttt
atcgaaatttggaacctagtattcatgcaatacaaccgtcatgctgacggtacaatggag
cctttaccaagccaatctgttgatacaggtatgggccttgagcgtatttctgccattatg
cagggcgttcactcaaactacgaaatcgatattttccaaaacttaattaaagctgcggct
gcggttactaatgcgcaagatttagaagataaatcattacgtgttattgcagaccatatt
cgttcgtgtgcgtttttaattgctgatggtgtgatgccatcaaatgaaggccgtggttac
gtattacgtcgtattattcgtcgtgcagtgcgtcacggcaataagttgggtgctactgaa
acattcttccataagttagttgctgcgcttgcaactgaaatgggtgaagcgtacccagag
ctaatcaagcaacagtcaattattgagaaagttctgcgtattgaagaagaacagtttggc
aaaacgcttgatcgtggtctggcgattttagaagaaagcctaaaaggtttacaaggcgat
gtaatcccaggtgatttagtctttaaactttatgatacctacggtttccctgctgattta
acggcagacgttgcacgtgaacgctttatgactattgatgaacgtggcttccaagaagca
atggaagttcaacgcaagcaagcacagcaagctggtaagtttggtgcagactacaatgac
cagttaaagtctgaaaaaacaacagaatttaaaggctacgatagcgagcaatacacaggt
acagtggttgaattatttagcggtgcagatgccgttactgttcttgaagacggacaacaa
ggtattgttattcttgatcgcacacctttctacgcagaaagcggtggtcaggttggcgat
acaggcgtacttaaagttgctaatggtgagtttattgttgaagacaccacaaagctcggt
aatgcattcgcccacaaaggtaaagttgttggtcgtattggtgtgaatgaccgtgttgat
gcacatgttgatgcaacacgtcgcgataacactaagaaaaaccacactgcaacgcactta
ttacacgaagcacttcgtgtggtacttggcgaacatgttacacaaaaaggttcattaaac
gacccagagcgtttacgttttgacttctcacactttgaagcagtaacaaaagaagagtta
caacgcattgaagatatggtgaatcttgagatccgtaagaatatcgacctgaacaccgaa
ttaatggcaattgacgcggcgaaagaaaaaggcgcaatggcgttatttggtgaaaaatac
gacgatgaagtgcgcgttgtaagcattggcgacttttcaattgagctatgtggtggtacg
cacgttaagcgcactggtgacatcggtttatttaagattgtgtcagaaagtggtattgca
gcaggtgttcgtcgtattgaagcggtaacgggtgaaggtgcagttgcttatatcaataaa
caagctgaaacattatcagcaattgctgcgctagtgaaaggcgatagcaataatgtgtta
gacaaagtatcagctttagttgagcgtgctaaaggccttgaaaaggaaatttctcagctt
aacgataaactagcaagtgcagctggtgcgtcattacttgacgctgtaattgatgtaaat
ggcgttaaattactggtagcaaatgttgaaggtactgagtcaaaagcattgcgtggcatg
gttgatgaccttaaaaataagcttggctctggcattattgcgcttggtgttgccaatggt
gacaaagtaagtctaattgccggtgtgacgaaagacttaactggtcagtttaaagccggt
gagcttgttaaccacatggcgtcgcaagtaggtggtaaaggcggtggtcgtcctgatatg
gcgcaagccggtggttcacaacctgaaaacttagctgcagcacttgaaagtgtgaatgcg
tgggtgagtgagcgcgcttaa

DBGET integrated database retrieval system