KEGG   Pseudoalteromonas piratica OCN003: OM33_13405
Entry
OM33_13405        CDS       T03513                                 

Definition
(GenBank) permease
  KO
K07091  lipopolysaccharide export system permease protein
Organism
pseo  Pseudoalteromonas piratica OCN003
Pathway
pseo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pseo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    OM33_13405
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pseo02000]
    OM33_13405
Transporters [BR:pseo02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    OM33_13405
SSDB
Motif
Pfam: LptF_LptG FtsX
Other DBs
NCBI-ProteinID: AIY66001
UniProt: A0A0A7EIW3
LinkDB
Position
1:2900497..2901612
AA seq 371 aa
MLIFRYLSTEVFKSQLAVFLTLMTIFVSQKFVSILADAAEGSIPGQLVLQMVMLKLPQLA
SLILPLSIFLGIILAYSRIYADSEMTVLKACGVSEWYVVRLTLISSTLLAILAGFLTLKL
APWANEHEYQLKEKIEADAGLAALRSGRFQQTDNEKAVVFIHDINQGGTELDRVFYAQID
RDSEMRTSEVVYAEKGKVLEDDNTGEQKLILSDGKRYENPAGSKQLQLTEFTNYEVQIQD
QAIEQKRRKLEALPSMQLLEQGSKEAIAQFQWRLAVPLSIPLLTLIAVPLSVVNPRQGKF
AKLVPAISLYLGYFVLLNAGTFLVQDGKIPTSIGLWWIHLSALFIGTFLILRDRPLGSTI
RAWFSKKEATA
NT seq 1116 nt   +upstreamnt  +downstreamnt
gtgttaatctttcgctatttatcgacagaagtatttaaatctcagctcgcggtattcctc
actctgatgacaatttttgtcagtcagaagtttgtgtctattttggctgacgccgcagaa
ggctcaatacccgggcaattagtactgcaaatggtaatgcttaagctcccccaattagcg
tcattaattttacctctgagtattttcttgggcattattctggcctacagtcgcatttat
gccgacagtgagatgacggtattaaaagcatgcggtgttagcgagtggtatgtggtgcgc
ttaactttaatctcttcaacactgctcgcaattttagccgggtttcttacgcttaagctt
gctccttgggcgaatgagcacgaatatcaattaaaagaaaaaatagaagctgatgccggc
ctcgcagccctccgttcagggcgatttcagcaaaccgataacgaaaaagctgtagtgttt
atacatgatattaaccaaggtggaactgagcttgaccgcgtattttacgcgcaaatagac
agagacagtgagatgcgtacctccgaggtagtctacgcagaaaaaggtaaagtattagaa
gacgacaatacaggtgagcagaaactaattttgagtgatggaaaacgctacgaaaatcca
gccggttcaaaacagctccagttaactgaatttacaaactatgaagtgcagatacaagat
caggccattgagcaaaagcgtcgaaagcttgaagcgctgccctctatgcaactattagaa
caagggagtaaagaagccatcgctcagtttcaatggcgcctagctgtgcccttatcgatt
cctttacttaccctaattgctgtgcctttatcggttgttaatccgcgtcaaggcaagttt
gctaaattggtacctgcaatttcgctctaccttggttacttcgttttattaaatgcgggc
acgtttttagtgcaagacggaaaaataccaacttcaataggtctatggtggatccaccta
agcgcattgtttattggtactttcttaattcttagagataggcctcttggctctacaatt
agggcatggtttagcaagaaggaggctaccgcatga

DBGET integrated database retrieval system