KEGG   Pseudonocardia sp. EC080610-09: AD006_01010Help
Entry
AD006_01010       CDS       T04146                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
pseq  Pseudonocardia sp. EC080610-09
Pathway
pseq00250  Alanine, aspartate and glutamate metabolism
pseq00410  beta-Alanine metabolism
pseq00640  Propanoate metabolism
pseq00650  Butanoate metabolism
pseq01100  Metabolic pathways
pseq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pseq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AD006_01010
   00650 Butanoate metabolism
    AD006_01010
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AD006_01010
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AD006_01010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pseq01007]
    AD006_01010
Enzymes [BR:pseq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AD006_01010
Amino acid related enzymes [BR:pseq01007]
 Aminotransferase (transaminase)
  Class III
   AD006_01010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ALL74251
LinkDB All DBs
Position
complement(217539..218795)
Genome map
AA seq 418 aa AA seqDB search
MAQLSPLLKQATPVQAARGEGVYLYDTDGRRHLDFTAGIGVTSTGHCHPTVVKAAQEQVG
TLIHGQYTTVMHQPLLKLVERMGEVLPEGIDSVFFTNSGSEAVEASVRLARQATGRSTIV
AFDGGFHGRTMGAAALTTSGAKIRAGIGPMMGGVAFSPFPYAYRYGWSEEDTVAFALREL
DRVLASSAPASDVAAFIVEPVLGEGGYVPTPSAFLHGLRERADKHGILLIADEVQTGYGR
TGRFWGHQHAEGFTPDVIVTAKGLASGFPLSAIAAPKAIMEKAWPGSQGGTYGGNAVACA
AALATLDVVQGEGLVENARVQGEKLVAGVRDAAQGIAAIGDVRGRGLMVGIEFVDAAGNP
DGATAAKVHAAAAAQGLLLLTCGVQGNIVRMIPPLVVTGEQIDEGLALWTKALDDALS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctgtccccgctgctgaagcaggccaccccggtccaggccgcccgcggtgag
ggcgtctacctgtacgacaccgacggccgccggcacctcgacttcaccgccggaatcggc
gtcacgtccaccgggcactgccacccgacggtcgtcaaggcggcgcaggagcaggtcggc
accctgatccacggccagtacacgaccgtcatgcaccagccgctgctgaagctggtcgag
cggatgggcgaggtcctgcccgagggcatcgactcggtcttcttcaccaactccggttcg
gaggccgtcgaggcctcggtgcggctcgcgcgccaggccaccggccgctccacgatcgtc
gccttcgacggcgggttccacggccgcacgatgggcgccgcggcgctcaccacctccggt
gcgaagatccgcgccgggatcggcccgatgatgggcggggtcgcgttctccccgttcccc
tacgcctaccgctacggctggtcggaggaggacaccgtcgcgttcgcgctgcgcgagctc
gaccgggtcctggccagctccgcgccggcgtcggacgtcgcggccttcatcgtcgagccg
gtgctcggcgagggtggctacgtcccgaccccgtccgcgttcctgcacggtctgcgggag
cgggccgacaagcacggcatcctgctgatcgccgacgaggtgcagacgggctacggccgc
accggcaggttctggggtcaccagcacgccgagggcttcacgccggacgtcatcgtcacc
gcgaaggggctcgcgtccgggttcccgctgtccgcgatcgccgcgccgaaggcgatcatg
gagaaggcctggccgggctcgcagggcggcacctacggcggcaacgccgtcgcctgcgcc
gcggccctggccaccctggacgtcgtgcagggcgagggtctcgtcgagaacgcccgggtg
cagggcgagaagctcgtcgccggggtccgggacgcggcgcaggggatcgccgcgatcggc
gacgtccgcggccgtggcctgatggtcggcatcgagttcgtcgacgccgcgggcaacccg
gacggcgccaccgcggcgaaggtccatgccgccgcagccgcgcagggtctgctcctgctg
acctgcggcgtccagggcaacatcgtccggatgatcccgccgctggtcgtcaccggcgag
cagatcgacgagggcctcgcgctctggaccaaggcgctcgacgacgcgctgtcctga

DBGET integrated database retrieval system