KEGG   Pseudonocardia sp. EC080610-09: AD006_04015Help
Entry
AD006_04015       CDS       T04146                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pseq  Pseudonocardia sp. EC080610-09
Pathway
pseq03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pseq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AD006_04015
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pseq03400]
    AD006_04015
Enzymes [BR:pseq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AD006_04015
DNA repair and recombination proteins [BR:pseq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AD006_04015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ALL74693
LinkDB All DBs
Position
complement(823421..824359)
Genome map
AA seq 312 aa AA seqDB search
MLPMLATPGPLPTGPGWSFEVKWDGMRVLASVTEGDDGRALVLRTRSGRDVTANFPELAE
LAGAAPDVVLDGEVVLLDAGVPSFAALAHRMQGVVGAAAAERRPVTFMVFDVLRLYGVSL
LDRPLSERRATLERLDLGALAHVEASPLYPDGASLLAVTAERGLEGVVAKKESSVYRPGR
RSPDWVKVAHRHSQSCVVGGRRPEKGSGSRIGALLLGVPGPDGLEFAGRVGSGLAGDAVQ
QLLTERLGPLTAESSPFAQTLPRLDAAGATWCTPRVVVEVAHLGWTAAGRLRQPVFRGIR
DDVDPTGVQREP
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcccatgctcgccacccccggaccgctcccgaccggtcccggctggtcgttcgag
gtcaagtgggacggcatgcgcgtgctggcatcggtcaccgagggtgacgacggccgggca
ctcgtcctgcgtacccgttccggccgggacgtcacggcgaacttcccggaactcgccgag
ctcgccggtgcggcccccgacgtcgtgctcgacggggaggtcgtcctgctcgacgccggc
gtccccagcttcgccgcgctcgcccaccgcatgcagggcgtcgtcggcgccgccgccgcg
gagcgccgccccgtcaccttcatggtgttcgacgttctgcggctctacggggtgtcgctc
ctcgaccggccgctgtccgaacggcgggccacgctggagcggctcgacctgggcgcgctc
gcgcacgtggaggcgtcgccgctgtacccggacggggcgtcgttgctggcggtgaccgcc
gagcgcgggctggagggcgttgtcgcgaagaaggagtcgtcggtgtaccggccgggccgg
cgcagcccggactgggtgaaggtcgcgcaccggcactcgcagagctgcgtggtcggcggg
cggcgcccggagaaggggagcggcagccggatcggggcactgctgctcggcgtccccggc
ccggacgggctggagttcgccgggcgggtcgggtccggtctcgccggtgacgcggtgcaa
cagctcctcaccgagcggctcggcccgctgacggcggagtcgtcaccgttcgcgcagacc
ctgccccggctcgacgcggccggggccacctggtgcacgccacgcgtcgtcgtggaggtc
gcgcacctcggctggacggcggccggccggctgcgccagccggtgttccgggggatccgc
gacgacgtcgaccccaccggggtgcaacgggagccgtga

DBGET integrated database retrieval system