KEGG   Pseudonocardia sp. EC080610-09: AD006_10065Help
Entry
AD006_10065       CDS       T04146                                 

Definition
(GenBank) hypothetical protein
Organism
pseq  Pseudonocardia sp. EC080610-09
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal Haspin_kinase Kdo
Motif
Other DBs
NCBI-ProteinID: ALL78560
LinkDB All DBs
Position
complement(2104200..2105915)
Genome map
AA seq 571 aa AA seqDB search
MVDVSVSEGEVQRRQIAGRYRVDGPLGSGAMGTVWSGFDDVLQRRVALKELKIPDGIPDG
EKQELRERIMREARALAGLSHPNVVTVFDVLDSGGEEPLVIMELVPSKNLASAISELGRL
DSAQAGVVGFGTAAALRAAHRAGITHRDVKPGNVLISDDGRIKLTDFGIARNESDAPMTS
AGLVLGSPAYIAPEVAAGQPVTPAADLWGLGATLYAAVEGRPPYDVDGDPVKTITEVVDG
PVPVPTMTGPIAEVISGLMVKEPAGRMPLDEVRARLRPLLADPDDPIFPGSPDVPTIMAR
VPAPTTPSGPQVQRPPRGVTPTGTGTYPRGGAPLAEPAPAPPPPPVAAPEPPRPAPARPA
PSAPARARAAGTRAPSGRPGGVAGVLGGIPLVLGGALLVLLGALGGFTGVRTLAGQEALS
TITVATERTPRVAHPDPLGFTVAIPQDWTQYRSPAGDGSAVVRFVSPDGRQELSVRAAAS
AAAVTDALTPEALGVDTVDATPATREPDGSSEVTLTTTSGPAERSTLLRIVPGRTPDGVW
VLQLTSPAGQAESAASGLFAAIAAGFRTTSS
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atcgtcgacgtgtccgtttccgaaggcgaggtccagcgccgccagatagccgggcggtac
cgcgtcgacggcccgctcggcagcggcgcgatgggcacggtgtggtccggcttcgacgac
gtcctgcagcggcgggtcgccctcaaggagctgaagatcccggacgggatccccgacggc
gagaagcaggagctgcgcgagcggatcatgcgcgaggcccgtgcactggccgggctctcg
caccccaacgtggtcaccgtcttcgacgtgctcgactccggcggcgaggagccgctggtg
atcatggagctggtgccgtcgaagaacctcgcgtcggcgatctccgagctgggcaggctc
gactccgcgcaggccggcgtcgtcgggttcggtaccgcggccgccctgcgcgcggcgcac
cgcgccgggatcacccaccgcgacgtcaagcccgggaacgtcctcatctcggacgacggc
cggatcaagctcaccgacttcggcatcgcccgcaacgagtccgacgcaccgatgacgtcg
gccggcctcgtgctcggctcgcccgcctacatcgcaccggaggtcgccgccggtcagccg
gtcacgccggccgccgacctgtggggcctcggcgcgaccctgtacgccgccgtcgagggc
cgcccgccctacgacgtggacggcgacccggtcaagacgatcaccgaggtcgtcgacggc
ccggtgccggtcccgacgatgaccgggccgatcgccgaggtcatcagcggtctcatggtc
aaggagccggccggccggatgccgctcgacgaggtccgcgcccggctgcggccgctgctc
gccgaccccgacgacccgatcttccccgggtcgccggacgtcccgacgatcatggcgagg
gtcccggcgccgaccacgccgtccggcccgcaggtccagcggccgccccgcggcgtgacc
cccaccgggaccggcacgtacccgcggggcggggcgccgctcgccgagccggccccggcc
cctccgccgccgcccgtcgcggcccccgaaccgccgcgccccgcgcccgcgcgaccggct
ccgtcggccccggcgcgcgcccgcgccgccggtacccgggccccgtcggggcggcccggc
ggtgtcgccggggtgctcggcgggatcccgctggtgctcggtggcgcgctgctggtgctg
ctgggagcgctgggcgggttcaccggcgtccgtaccctggccggccaggaggcgctgagc
acgatcaccgtcgcgaccgagcgcacgccgcgggtcgcgcacccggacccgctgggcttc
accgtggcgatcccgcaggactggacgcagtaccggtcccccgccggcgacggctctgcc
gtggtgcggttcgtcagcccggacggccggcaggagctgtcggtccgcgcggcggcgtcg
gcggccgcggtgaccgacgccctcaccccggaggcgctcggcgtcgacaccgtcgacgcg
acacccgccacccgggagcccgacggcagcagcgaggtcacgctcaccacgaccagtggt
cctgcggagcgcagcacgctgctgcggatcgtcccgggccgcacccccgacggcgtgtgg
gtcctgcagttgacgtctccggccggacaggccgagtccgccgcctccgggctgttcgcc
gcgatcgccgccggtttccggacgacgtcgagctga

DBGET integrated database retrieval system