KEGG   Pseudonocardia sp. EC080610-09: AD006_11470
Entry
AD006_11470       CDS       T04146                                 

Definition
(GenBank) acetolactate synthase
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
pseq  Pseudonocardia sp. EC080610-09
Pathway
pseq00290  Valine, leucine and isoleucine biosynthesis
pseq00650  Butanoate metabolism
pseq00660  C5-Branched dibasic acid metabolism
pseq00770  Pantothenate and CoA biosynthesis
pseq01100  Metabolic pathways
pseq01110  Biosynthesis of secondary metabolites
pseq01210  2-Oxocarboxylic acid metabolism
pseq01230  Biosynthesis of amino acids
Module
pseq_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
pseq_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:pseq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AD006_11470
   00660 C5-Branched dibasic acid metabolism
    AD006_11470
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    AD006_11470
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AD006_11470
Enzymes [BR:pseq01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     AD006_11470
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M POR_N E1_dh
Other DBs
NCBI-ProteinID: ALL75768
LinkDB
Position
2404934..2406643
AA seq 569 aa
MTEEDPSTVAALVARFLYDRGVRRVFGLQGGHIQPIWDRLARLGVAIVDVRDEAAAVHMA
HAHSELTGEMGIALATAGPGVTNTVTAVANASVSRIPLLLLGGCPPRPQANKHPLQDIPH
TEILRPVTRQSRTLRVGDEVLRELDEGWSRATGDAAEPGPVYLEIPTDVLRETVPPAVVL
DEHLRAPRRRRSLPHPDDVAAVAELLRGAEKPAVITGRGARTAPEELVRFLDATGAAYLD
TQEGRGLVPPGHPAVVGALRSRVMREADLVVTVGRQLDYQLGFGSPAAFPDARWVRVSDS
AGELHDNRRGEVEILADVGSTLDALAAAAGPDPDTTWRDGLRKAHLERFDGYRDALAATP
PGGDGRMHPNHIFAALNDLDLDGATVVADGGDLLSFARLGVPSVARYLDAGAFGCLGVGV
PFAIAAALANPDRPAIAVTGDGAFGINAMEVNTAVRHGVPIVVIVSNNAAWNIERYDQAE
NYGLVVGTELDGNDYAALGRALGAHGERVTEPGEMAGALERALANAPAVIDVVTSRDAPS
PDAGKGLGWVPDYQALTPWNDAEVKRREP
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgaccgaggaagatccgtccaccgtcgctgcactggtggcccggttcctgtacgaccgc
ggggtgcgccgcgtcttcggactgcagggcgggcacatccagccgatctgggaccggctc
gcccggctcggggtcgccatcgtcgacgtccgcgacgaggccgccgccgtccacatggca
cacgcccactccgagctcaccggcgagatgggcatcgcgctggcgaccgcggggcccggt
gtcacgaacaccgtcaccgcggtcgccaacgcgtccgtctcgcggatcccgctcctgctg
ctcggcggctgcccgccgcggccgcaggccaacaagcacccgctgcaggacatcccgcac
accgagatcctgcggcccgtcacccggcagagccgcaccctgcgggtcggcgacgaggtg
ctccgcgagctcgacgagggctggtcccgtgcgaccggcgacgccgccgagccggggccg
gtctacctggagatcccgaccgacgtgctgcgggagacggtgccgcccgccgtcgtgctc
gacgagcacctgcgcgcaccccggcgccgccgctcgctgccgcaccccgacgacgtcgcc
gccgtcgccgagctgctgcgcggcgccgagaagcccgccgtcatcaccgggcgcggagcg
cgcaccgcgcccgaggagctcgtccggttcctcgacgccaccggcgccgcctacctcgac
acccaggagggacgcgggctggtcccgcccggtcacccggccgtcgtcggggcgttgcgg
agccgggtgatgcgggaggccgacctggtcgtcaccgtcgggcgccagctcgactaccag
ctcggtttcgggtccccggccgcgttcccggacgcgcggtgggtccgcgtctccgactcg
gcgggggagctgcacgacaaccggcgcggcgaggtcgagatcctcgccgacgtcgggagc
accctcgacgcgctcgccgcggcggccgggccggatccggacaccacctggcgggacggc
ctgcgcaaggcacacctcgaacggttcgacggctaccgcgacgcgctcgccgccaccccg
cccggcggcgacggacggatgcacccgaaccacatcttcgccgcgctgaacgacctcgac
ctcgacggcgcgaccgtcgtcgccgacgggggcgacctgctcagcttcgcgcggctcggc
gtcccgtccgtcgcccgctacctcgacgccggcgcgttcggctgcctgggcgtcggcgtc
ccgttcgcgatcgccgcggcactggcgaaccccgaccggccggcgatcgccgtcaccggt
gacggggcgttcgggatcaacgcgatggaggtcaacaccgcggtccggcacggcgtgccg
atcgtcgtgatcgtctccaacaacgccgcctggaacatcgagcgctacgaccaggccgag
aactacggcctcgtcgtcggcaccgagctcgacggcaacgactacgccgcgctcggccgc
gccctgggtgcgcacggggagcgggtcaccgagcccggggagatggccggcgcgctggaa
cgtgcgctggcgaacgcaccggccgtgatcgacgtcgtgaccagccgcgacgccccgtcc
ccggacgcgggcaagggcctgggctgggtccccgactaccaggccctcaccccctggaac
gacgccgaggtgaagcggagggagccctga

DBGET integrated database retrieval system