KEGG   Pseudonocardia sp. EC080610-09: AD006_22575Help
Entry
AD006_22575       CDS       T04146                                 

Definition
(GenBank) cystathionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
pseq  Pseudonocardia sp. EC080610-09
Pathway
pseq00270  Cysteine and methionine metabolism
pseq00450  Selenocompound metabolism
pseq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pseq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AD006_22575
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AD006_22575
Enzymes [BR:pseq01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     AD006_22575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Met_gamma_lyase
Motif
Other DBs
NCBI-ProteinID: ALL77395
LinkDB All DBs
Position
complement(4908853..4910058)
Genome map
AA seq 401 aa AA seqDB search
MTHDDRPPHLATRAVHAGNDVDPGTGAIRRPIVAANSYALPEDPSDLDWSGTTTRLYTRN
GGANQGWLEDKLVALEDPAGAVPGGCAAVALASGVAALHAVFFTFLRSGDHVVSSDVTYV
ATHRLLTELLPDRYGITATLVDSSDPGAVRAAMRPGTRLVHVETPANPTTRIADVDAVAA
VAHAHGALLSVDATFATPVLQRPLERGADLVVHSLTKYVNGHGDAMGGAVLGARELVDRI
RADAMVDAGGVISPFNAWLIARGAVTLPMRMRAHCENALVVARFLESEPRVAYVAYPGLA
SHPQHELAARTLDGGFGGMLAFALDGPPELQNRFVAHLRVITSAVSLGHDESLVVHVGAG
SEGRAAHFPPDFRRLGHLRLSVGLEDPRDLVADIGQALARL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgacccacgacgaccggccgccccacctcgcgacgcgtgcggtgcacgccggaaacgac
gtcgaccccggcaccggcgcgatccggcgtccgatcgtcgccgcgaactcctacgcgctg
cccgaggacccgtccgacctggactggtcgggcaccaccacccggctctacacccgcaac
ggcggggcgaaccagggctggctggaggacaagctcgtcgccctggaggaccccgccggg
gcggtgccgggcggctgcgccgccgtcgcgctggcgtccggtgtggcggccctgcacgcg
gtgttcttcacgttcctgcgctccggcgaccacgtcgtcagctcggacgtcacctacgtc
gcgacccaccggctcctgaccgagctgctcccggaccggtacgggatcaccgcgacgctg
gtggactcctccgacccgggggcggtgcgggcggcgatgcggcccgggacccggctcgtg
cacgtcgagaccccggcgaacccgacgacccggatcgccgacgtcgacgccgtcgccgcg
gtcgcgcacgcccacggcgcactgctctcggtggacgccacgttcgccacaccggtgctg
cagcgcccgctcgagcgcggagccgatctcgtcgtccactcgctgacgaagtacgtcaac
gggcacggcgacgcgatgggcggcgccgtgctgggggcgcgcgagctggtggaccggatc
cgggcggacgcgatggtcgacgccgggggagtgatcagcccgttcaacgcctggctgatc
gcgcgcggcgcggtgaccctgccgatgcggatgcgggcgcactgcgagaacgctctggtc
gtggcccggttcctggagtcggagccgcgggtcgcctacgtcgcctacccgggcctggcg
tcgcacccccagcacgagctggccgcccgcaccctcgacggcggattcggcgggatgctc
gccttcgccctcgacgggccgccggaactgcagaaccgcttcgtcgcgcacctgcgggtc
atcacctcggcggtgtcgctcgggcacgacgagtcgctggtcgtgcacgtcggcgccggc
tccgagggccgggccgcgcacttcccgccggacttccggcgcctcgggcacctgcggctc
tcggtcgggctggaggacccgcgggatctcgtggccgatatcgggcaggcgctggcgcgc
ctgtga

DBGET integrated database retrieval system