KEGG   Pseudanabaena sp. ABRG5-3: ABRG53_0927Help
Entry
ABRG53_0927       CDS       T05820                                 

Gene name
rpiA
Definition
(GenBank) ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
pser  Pseudanabaena sp. ABRG5-3
Pathway
pser00030  Pentose phosphate pathway
pser00710  Carbon fixation in photosynthetic organisms
pser01100  Metabolic pathways
pser01110  Biosynthesis of secondary metabolites
pser01120  Microbial metabolism in diverse environments
pser01130  Biosynthesis of antibiotics
pser01200  Carbon metabolism
pser01230  Biosynthesis of amino acids
Module
pser_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pser_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
pser_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pser_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
pser_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pser00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ABRG53_0927 (rpiA)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ABRG53_0927 (rpiA)
Enzymes [BR:pser01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     ABRG53_0927 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind
Motif
Other DBs
NCBI-ProteinID: BBC23184
UniProt: A0A2Z5WUZ9
LinkDB All DBs
Position
complement(1036068..1036781)
Genome map
AA seq 237 aa AA seqDB search
MSISAEDIKKLKQEVGIAAAQRVKSGMVVGLGTGSTTAFAIEELGRRIAAGELTDIVGIP
TSFQASVLGKKYGIPIRSLDDVDRVDVAIDGADEVDPHKTLIKGGGAAHTREKVVDSLAS
LFIVVVDESKLVDKLGSTFAVPIEVLPMAVAPVTRAVEKLGGKPDLRMGVKKDGPVITDQ
GNMVLDVTFDAIADAAELEKTLNNIPGVVENGLFVGVTDLILVGEFKDGKPQIREIS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttctgctgaagatattaaaaagttaaaacaagaagttggaattgcggcggcg
caacgagtcaagtctggaatggtcgttggcttaggtactggatcaactactgcttttgcg
atcgaggagctaggtagacgcattgcggcgggtgaacttactgacattgttggtatcccc
acctccttccaagcttcagtactaggaaaaaaatatggtattcctatccgcagtcttgat
gatgtcgatcgcgtagatgtagcgatcgatggtgctgacgaggttgatcctcataagact
ttgattaagggtggtggcgcagcccatactcgcgaaaaggtagttgattccctcgcaagc
ctctttatcgttgtagtcgatgaatcgaaattagttgataagctaggttctacctttgct
gtacccatcgaagttttacctatggctgttgcgcctgtaactagagctgtagaaaagctt
ggtggtaagcccgatctgagaatgggcgtgaaaaaagatggtcccgtaattaccgatcaa
ggcaacatggttttagatgtcacctttgatgcgatcgctgatgctgctgaactagaaaag
accttaaacaatatccccggtgtagttgagaatggtctctttgttggcgttaccgatctg
atcttagttggtgaatttaaagacggaaaacctcaaattcgcgaaatttcctaa

DBGET integrated database retrieval system