KEGG   Pseudanabaena sp. ABRG5-3: ABRG53_3528Help
Entry
ABRG53_3528       CDS       T05820                                 

Gene name
pdhC
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pser  Pseudanabaena sp. ABRG5-3
Pathway
pser00010  Glycolysis / Gluconeogenesis
pser00020  Citrate cycle (TCA cycle)
pser00620  Pyruvate metabolism
pser01100  Metabolic pathways
pser01110  Biosynthesis of secondary metabolites
pser01120  Microbial metabolism in diverse environments
pser01130  Biosynthesis of antibiotics
pser01200  Carbon metabolism
Module
pser_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pser00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABRG53_3528 (pdhC)
   00020 Citrate cycle (TCA cycle)
    ABRG53_3528 (pdhC)
   00620 Pyruvate metabolism
    ABRG53_3528 (pdhC)
Enzymes [BR:pser01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ABRG53_3528 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BBC25785
UniProt: A0A2Z5X2H1
LinkDB All DBs
Position
3914747..3916072
Genome map
AA seq 441 aa AA seqDB search
MIYEIFMPALSSTMTEGKITSWVKSPGDKVEKGETVVIVESDKADMDVESFYEGYLGVII
TPEGESAPVGSAIAYVAETKEEIEEAKKKAANGKTGATTPETKPQTGNEEPPSKLVSSPT
AAATASIPDTVISSPRKAAPSAVPSGRQIVSPRAKRIAKDNGVDLTKIAGTGPNGRITAA
DVEAFLSPAAAPAPVQATAPAKVSAPATAKAAAAPVALGTAQSLTTLQKAVINNMNQSLS
VPTFRVGYTITTDALDALYKQVKSKGVTMTALLAKAVAVTLQKHPLVNASLSDRGIEYKS
NINVAVAVAMDDGGLITPVLKNADQTDLYTLSRDWKGLVERARAKQLQPDEYNSGTFTIS
NLGMFGVDRFDAILPPGTGAILAIGGSRPQVVATKDGAIKVASQMQVNLTADHRVIYGAH
AAQFLQDLAKLIETNPQSLTL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaattttcatgcccgcgcttagctccaccatgactgaaggtaaaatcacc
tcttgggtgaaatcccctggcgataaggtggaaaaaggcgaaactgtcgtgatcgtagag
tcggacaaagccgatatggatgtcgaaagcttctatgaaggctatctcggggtaatcatc
actcccgaaggcgaatctgcccccgtcggatcggcgatcgcctatgttgccgaaactaaa
gaagaaattgaagaagccaagaaaaaagcggctaacgggaaaacaggtgcaactactcct
gaaaccaaaccccaaacaggtaatgaagaaccaccttccaagctagtttcatcaccgact
gctgccgcgactgcctcaattcccgatactgtgatctcctcacctcgcaaagctgcacct
agcgctgtaccatcaggtcgtcagatcgtatcccccagagccaagcgcatcgccaaggat
aatggcgttgacctcaccaaaattgctggtacggggccaaatgggcgaatcactgctgct
gatgtcgaagccttcttaagtcctgctgccgcacctgctcctgttcaggcaaccgccccc
gcaaaggtgtcagcccctgcgaccgctaaggctgctgcggctcctgtagctttaggtact
gctcagtccttaacaactttgcaaaaggcagtgatcaataacatgaatcagagcctctca
gtacccacattccgtgtgggctacacgattactactgatgctctcgatgctctttacaag
caagttaagtccaagggtgtgaccatgacggcacttttggctaaggctgtggcggtaact
ctacaaaagcatcctttagtgaatgccagcctcagcgatcgcggtatcgagtacaagagc
aatattaatgttgccgttgcggtggcgatggatgatggtggtttgattacgcctgtgttg
aaaaatgccgatcaaactgatttatatactctttcccgtgactggaagggacttgtagaa
cgcgcccgtgcgaagcagttgcagcccgatgaatataactctggcacattcaccatttcc
aacttgggtatgtttggcgtggatcgctttgatgcaattttgcctcctggaactggcgca
attttagcgatcggtggttctcgtccgcaagttgtggcaactaaggatggtgcaatcaag
gttgctagtcaaatgcaagtcaatctcacagccgatcaccgtgtgatctatggcgctcat
gcagcacagttcttacaagatctagccaagttgattgaaaccaatcctcaatctttgact
ctgtaa

DBGET integrated database retrieval system