KEGG   Pseudanabaena sp. ABRG5-3: ABRG53_c066Help
Entry
ABRG53_c066       CDS       T05820                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pser  Pseudanabaena sp. ABRG5-3
Pathway
pser00480  Glutathione metabolism
pser01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pser00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ABRG53_c066
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pser02000]
    ABRG53_c066
Enzymes [BR:pser01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ABRG53_c066
Transporters [BR:pser02000]
 Other Transporters
  Pores ion channels [TC:1]
   ABRG53_c066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3 GST_C_5 Glutaredoxin GST_C_6
Motif
Other DBs
NCBI-ProteinID: BBC26905
UniProt: A0A2Z5X5M2
LinkDB All DBs
Position
ABRG53c:71553..72221
Genome map
AA seq 222 aa AA seqDB search
MSKIQLYSAKACPYAHRTRLVLGEKGIDFEYTEIDLQNKPEWFSKISKYGKVPALRHGEN
EVYESAIINEYINDVFPDPALLPKDAGSRAIARIWIDYANTKFTSAFGKLLRGKTAEEQE
QGRTELNEAILFIENEALTKLLGDGAYWFGENISLVDLTFYPWFERIPTLEHYRNYTIPT
EAVRVKRWWDAVSNRPAVKAIANPVDFYIERYAKFIQQPVAV
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaatccaactctatagtgccaaagcctgtccctatgctcatcgcactcgtcta
gttctaggcgaaaaagggattgactttgaatataccgaaattgatttgcagaacaaacct
gaatggttctccaaaatttctaagtatggcaaagttcctgcgctccgtcatggagagaat
gaagtttatgaatcggcgattatcaatgaatatataaacgatgtattccctgaccctgct
ttgcttccaaaagatgctggttccagagcgatcgctagaatctggattgactatgccaat
actaaattcacatctgctttcggtaagttattgcgaggcaaaactgctgaagaacaggag
caaggtcgcaccgaattaaacgaagcaattttattcattgagaatgaagccttaactaag
ctcttaggtgacggtgcttactggttcggagaaaatatttccctcgtcgatctcaccttc
tatccttggtttgagcgcattcctaccctagagcattatcgcaattacacgattcccaca
gaagctgtgcgcgttaagcgttggtgggatgctgttagcaatcgccctgcggtaaaagcg
atcgccaatcccgttgatttctacattgaacgctacgccaagtttattcaacagcccgtt
gcagtttag

DBGET integrated database retrieval system