KEGG   Pseudanabaena sp. ABRG5-3: ABRG53_d007Help
Entry
ABRG53_d007       CDS       T05820                                 

Definition
(GenBank) hypothetical protein
Organism
pser  Pseudanabaena sp. ABRG5-3
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BBC26972
UniProt: A0A2Z5X5Z7
LinkDB All DBs
Position
ABRG53d:6462..14057
Genome map
AA seq 2531 aa AA seqDB search
MSENTTTTFADNDDLPDDIPLGNNSPLLVPQPLGQSFLQPKFIYPLGAVSIINPDNLSLE
TDFEPLSDSFDNSPFFDNPLQSHDSGAISPSSTQVNLQTKSLPSSQKSQVQRSPNPKTQS
TSIQRKASAPNQPISSRNSSQSIATSENQESPQDVENDAQFLQNSSDLSISSDELELDFS
ENVSNIENKSVQRSSDNSSIGDVTKDFTDISLVENIDNSDLEIYQNNESNSQLIQKSADT
SSFDSSTRDNTISEDRLSPNSENSSNLTTNTTSFIRDISTSDIQRESQSPNVVNSIENIK
SREEVTNLDSNSSLIQRDIVNTVSENIRVSDNNQESQVVNNNFDSSSLISLSVDSSLQSE
QFQPIQRTTNLSTDINASEGISSEIEHSTSSSSNLSSEKVDNSSSQSQEIQRQVDAYDQE
KFSDRNDSITINSSYSNLVTNISEDNSLQISQENLYTTANSSIESIQRNLDVSNASLEDD
LSQENNLTNLIQRQLDAPIVDSNSYQEDTLISNPNQTTLQISNHNQPSQSQNLQKQPDIY
TSDPSLDNSISGNEPPSISNNSQLSNIDLVIQKKSDITVDNRNQVTSPIKSTQDDTNISA
IEELSTSNEFLNDYTTQDLSSDLLINNVSINNASINTNNINQVQAKADLSTTVNNDISQD
DLPSDHISGMQSIETPVTSDSNLITGLNTLQRSVISPSLESVNVQQNLVSEVSEDLSIKS
DKLDANSISVNNIESLSQINDSPPPANLDPISEPEENNNSNYDITQNTLSNEYSLGVQRE
LSLSLSSSSGISSQNNLNKLITKDSSQIDINENLVDSKASPTIQTQLFQDNLSDTSRDNI
EQSILSSETSNLEQPLTRNVTQRDINENLTDVVTSPVIQTYLDQDNLSNTTNINVDNIEQ
SNLYSETSDLQQLIEEDTLQLHTDENLLDVETSPTVQTQLDRDDLSNINRDNIEQSNLFT
VTSSLDIQKKINLDNISSQNDLTQDGYDYTDRPVDNIHLQSTDNQGIQREANIETRTIVS
SDLQNSNIQRDLNDSSQELKLDDLSDSFIPDEEINDNQLSEKSANSDRIDTFTNIQKQES
QEFSNLVDTSISSDTISTSDTNDIQSDRLDNQIQRQIESSPNNLNTAQGFTDLSVDQNLS
SPSQEIISTFNLIDISYVNSPEIEHLTEPSQLQRSSFNVDGISISDIETNIDDINVLSSS
PEPEIQRSLETSTININNLDSSNIELNQEIPLHESSQTIDDLQSISTERNIEPNDLDNID
FDIQRQTDKYTPENYDLLTDNMSNNLNDSIVQLDSSQSVVENVITRQIGQEESDLSSNNI
LENETEEVLKASNIEESIQREIAVDANESNDLRNIEILDVQADMNSDTSQISSKVSDQVI
QTSLDSINTNNGLISDLPEVSNNNSLTDNLDNSYAVHVQKQGVQKQSENITDLDNIPDPL
IQREPDPPVNKSINTEDIISSQSPQIARDLSSEYNSSYTNLDAANDYLDAPLANENNSTS
NLDEISNGSANNIQRQFANDSIADRVDIIDSSSMNSSYDLSSSLSVEDSNTLTSDRSRSL
PVENIQSSIDSSTSNFNLGVDERQAIQRQINEDSISSSVDLNDSDRDLVDVQSAIDTFGI
NERISLANTSSTDPISDTSSNDNLNISTSRSNEIQREFDASVNEISNVNEISARDKISVE
NIDLANNSNVERSISNDINIQRSQLDSESFMNENANDIDSINIVSPTSNQQLVTTSDLPV
IDSNISLSGESQILQRTFALNDTSIGLSNNISIQDDNQYDQQLRQSIDNINNTSILTSDL
SPQLQRSSDQLEGNQLNGETNVDEILSQGKLAQTGQETQQISESVSELNQTSGEIQRKNE
ASIPNRSLDTRDLGDISLATVESPQNDLSVSFNDNQVSNFSSIENIDTVSPSVLQSKPNP
VTDSQTSSNIISNDFQQDDPSQTIQRDSLNNSNLDDSNSVEIIQTNALLSDTDPQIIQTK
SNLSQAINNIDNNVLGGSNDTIQAKYISTNLESIESIDSMDRNIDVNLDDNFDNNTANTS
SDISVQRISNISEINPEASSQTTNQEFDHNLNISDVELNISDVENIQKKSDDINNIERIS
ESNISSSPALIQTASDVDNVIQNIDDLDRLNNSNILDTNTNISRHSETENINNTSAVDNI
DIHDIQRKPKQDAVDNTNIQDIQRKSEQDDHIIVAESFNTNNLQNVVDSDRISIIQPKSD
IPQLETISQSGIISAETTNQLEATNEPTVIQRLSDLANPTEDLTLPTVLQNLGQTEPLVK
FSSLTNEQPNHQITTNNLSNLSSNSNPSSQSNLSNSSRLSQLLQAKGNSSTLSSSTNKIS
TTPTSIQPKLDQNQNNDAQEAKSPSWSNIAELLAKMPPPKVSSNPSTNSLNKKAVSSSDR
SSLASQPKSITTSTSKSTSNQTIIQRSPDDRNDDDLDLYITPTGLQRGNPNQVTNSQVNP
IQRKKDPHQDNENLPEATVSVNNFQDNDNKDEANFEENLTALAQEIYVLLRQRLEIEKER
QGSIYRGRLPW
NT seq 7596 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgaaaataccacaacgacctttgccgataatgatgatttgcctgatgacattccc
ttaggcaataattctccattgcttgtgccgcaaccattggggcaatcatttttacaacca
aaatttatctatcccttgggagcagtttcgattatcaatccagataacttgagtcttgaa
actgattttgagcctcttagtgatagtttcgataattccccattttttgataatccctta
caatctcatgattctggagcgatatctccatccagtactcaagtaaatcttcaaaccaag
tcgctaccatcatctcaaaagtcacaagttcagcgatcgcctaatcctaaaactcaaagt
acatcaattcaaagaaaggcttcagcgcctaatcaaccaattagctccagaaatagttcg
caatcaattgcgacatcagagaaccaagaatctccgcaggatgtagaaaatgatgctcag
tttctgcaaaatagttcggatttatctatctcgtctgatgagctagaattagatttctca
gaaaatgttagtaatatagaaaataaatctgttcaaagatcttctgataactcttctatt
ggtgatgtaacaaaggattttacggatatttctcttgtagagaacatagataattctgat
ttggaaatatatcaaaataatgagtctaactctcaattaatccagaaatctgctgatact
tctagtttcgatagctctactagagataatactatttcagaagatagactcagtcctaac
tctgaaaactcgtccaatctcactacaaatacaacttcttttataagagatatctctact
tcagatatacagagagaatcccaatctcctaacgttgttaacagtatagaaaatataaaa
agcagggaagaagttactaatttagacagtaattcttcactaatacaaagagatattgta
aatactgtcagtgaaaatattagggttagcgataataatcaggaatctcaagtagttaat
aataattttgatagctctagtttaattagcttatcagttgatagtagtttacaatctgaa
caatttcaaccaatacaacgaacaactaatttaagcactgatattaatgcttctgaaggt
atttcctcagaaatagagcattctacttcttcaagttcaaacttatctagtgaaaaagtt
gataattctagctctcaatcgcaggaaatacaaaggcaggttgatgcatacgatcaagaa
aaatttagcgatcgcaacgattctatcactataaactctagctattctaatcttgtaaca
aatatctcagaagataactcccttcaaatatctcaggaaaatttatatactactgccaat
agttcgattgaatctattcaaagaaatttagatgtatcaaatgcatcattagaagacgat
ttatctcaagaaaataacttaacaaatttaattcaaagacaacttgatgcacctattgta
gatagtaattcttatcaagaagatactttaattagtaatcctaatcaaactacactacaa
atatctaatcataatcagccttctcaatcacaaaatctacaaaaacaacctgatatctat
actagcgatcctagtttagataattccatatctggtaatgaacctccatcaattagtaac
aattctcaattatccaatattgacttagtaattcagaaaaaatctgatattacagtagat
aatcgaaaccaagttacttctccaattaaatcaactcaagacgacactaatataagtgca
atagaagaattaagtaccagcaatgagttcttaaatgattatactactcaagatttatca
agtgatttgctgataaataatgtttctataaataatgcttctataaatactaacaatatt
aatcaagttcaggcaaaagctgatttatcaacaacagtaaataatgatatttcacaagat
gatttgccaagcgatcacatttctggaatgcagtcaatagaaactcctgttacatctgat
agcaatctaattactggtttaaatacactacaaagaagtgttatttctcctagtctagag
agtgttaatgtacaacaaaatctagtatctgaagtttcagaagatttgagtataaaaagt
gacaaattagatgctaattcaataagtgttaataatatagaatcactatcacaaattaat
gattctccaccccctgctaatttagatccaatatctgagccagaagagaataataattca
aattatgatatcactcaaaacactctatctaatgaatactctttaggagttcaaagagag
ctatctctatctctatctagctctagtggtatttcctctcaaaataatttgaacaaatta
attacaaaagatagttctcaaattgacataaatgagaacttggtagatagtaaagcttca
ccaacaatccagactcagctatttcaggataatttgtctgatacaagtagagataatata
gagcaaagtattttatctagtgaaactagtaatttagaacaaccacttacaagaaatgtt
actcaaagagatatcaatgaaaacctaacagatgttgtaacttctccagtaatacagact
tatctggatcaggataatttatctaatacaactaatataaatgtagataatatagagcaa
agtaatctatatagtgaaactagtgatttacaacaactaattgaagaagatactcttcaa
ttacatacagatgaaaacctgctagatgttgaaacttctccaacagtacagactcagcta
gatcgggatgatttatctaatataaatagagataatatagagcaaagtaatctatttact
gtaactagtagtttagatatacagaagaaaatcaatttagataatatctcatcacaaaat
gatctaactcaggatgggtatgactatactgatagacctgtcgataatattcatttgcaa
agtactgataaccaaggtattcaaagggaagccaatatagagacgaggactattgtctca
agcgatttgcaaaactctaatattcagagagatttaaatgactcgtcacaagaattaaaa
ttagatgacttatcagattcgtttattcctgatgaggagataaatgataatcaattaagc
gaaaaatctgctaatagcgatcgcattgatacatttaccaatattcaaaaacaggaatct
caagaattttctaatttagttgatacttccatctcttcagacactatatctacctcagat
actaacgatatccaaagtgatcgccttgataatcaaattcaaagacagatagaatcgtca
cctaataacttaaatacagctcagggttttactgatttaagtgtagatcagaatttaagt
agcccctctcaagaaattatatctactttcaatttaattgatattagctatgttaattcc
ccagaaatagaacatttgacggaaccatcccagttgcagagaagtagttttaatgtagat
ggcataagtatttcagatattgaaactaatatagatgatataaacgtcttatcaagtagt
cctgagccagaaattcaaagatcattagaaacatctactataaatataaataatctagat
agttcaaatatagaattaaatcaagaaattccattacatgagtcatctcaaacaattgac
gacttgcaatctatatctactgagcgcaatattgagcctaacgatttagataatattgac
tttgatatacaaaggcaaactgataaatatactccagaaaattatgaccttcttactgat
aatatgtctaataaccttaatgatagtattgttcaattagatagctcacagtcagttgta
gaaaatgttattactagacaaatagggcaagaagagtctgatttgtctagtaacaatatt
ttagaaaatgaaactgaagaggttttaaaggctagtaatatagaagaatcaattcaaaga
gaaattgctgtagatgctaacgaatcaaatgatcttcgcaatatcgaaattttagatgtt
caggcagatatgaactctgatactagccagatttcatctaaagtttcggatcaagtaatt
caaaccagcttagattctattaacaccaataatggtttaattagtgatttgcctgaggtt
tctaataataatagtttaactgataatttagataatagttatgcggtacatgtacagaaa
cagggtgtacagaaacaatctgaaaatattactgatttagataatatacctgatccgctg
attcagagagaacctgatccacctgttaataagtctatcaacactgaagatattatttct
agccaatctcctcaaatagcaagagatttatcgagtgaatataattctagttataccaat
ttagatgcagctaatgactatttagatgctcctctagctaatgagaataatagcacaagt
aatttagatgaaatttctaatggaagtgctaataatattcagaggcaatttgctaatgat
tcaatagctgacagagttgacataattgatagttctagtatgaattctagttatgatcta
tcgtctagtttatcggttgaagatagtaatacattgactagcgatcgctctcgaagtttg
ccagtagaaaatattcaatcaagtatagactcgtcaacttctaactttaatttaggtgtt
gacgagagacaggcaatacaacgacaaattaatgaagattctatcagttcatctgttgac
ttaaatgatagcgatcgcgatttagtagatgtacagagtgcgatcgacacatttggtatc
aacgaacgcatttcattagctaacacttctagtacagatccaatttctgatacatctagt
aatgataatcttaatatttctactagtagaagtaatgaaattcagagagagtttgatgca
agtgtaaatgagatttccaatgtaaatgagattagtgctagagataaaattagtgttgag
aatattgatttagctaataattctaatgttgaaagaagcatatcaaacgatataaatatt
cagaggtctcaattagattctgaatctttcatgaatgaaaatgcaaatgatatagacagt
attaatattgtatctcctacttctaatcaacagctagtaacgacctctgatttgccagtc
atagatagcaatatttccttaagtggagagtctcaaattttacagagaacttttgctttg
aatgatacaagtataggtttatcaaataatatttctatacaagatgataatcagtatgat
cagcaactaaggcaatcaattgataatattaataacacttctattttaactagtgattta
tctccacaattacaaagatcaagcgatcaattagaggggaatcagcttaatggagagact
aatgtagatgaaatattatctcagggtaagttagctcaaacaggtcaagagacacagcaa
ataagtgaatctgttagtgagctaaatcaaacaagtggggaaatacaacgaaagaatgag
gcatctattcctaatcgatctcttgatacccgtgatttaggcgatattagtctagctact
gtagagagtcctcaaaatgatctctctgttagctttaatgacaaccaagtgtctaatttt
tctagtatcgaaaacattgatactgtatctccttcagtattacaaagtaagccaaaccca
gttactgattcacaaacttcttctaatattatcagtaatgattttcagcaggatgatcct
agccaaactattcaaagggactctttaaataattccaatttagacgactctaattcggta
gaaataatacaaacaaatgctcttcttagtgatactgatccacaaataatccagaccaaa
tctaacttaagtcaggctattaataatatagataacaatgttctaggaggttctaatgat
actattcaagcaaaatatataagtacaaatttagaatccatagaatctatagattctatg
gatagaaatatagatgttaatttagacgacaattttgataataatactgctaatacatct
agtgatatctcagttcaaagaatatcgaatatatcggaaattaatcctgaagcttctagc
cagactacgaatcaagaatttgatcacaatttaaacatatctgatgtagagttaaacata
tctgatgtagagaatatacagaaaaaatcggatgatatcaataacattgaaagaatatca
gagtctaatatctctagctctccagctttaattcaaacagctagcgatgtagataatgta
atacaaaatatagacgatttagatagattaaataatagtaatattttggatactaatact
aatatttctcgccatagtgaaactgagaatattaataatactagtgctgttgataatatt
gatattcacgatattcaaagaaagcctaagcaagatgctgttgataatactaatattcag
gatattcaaaggaaatctgagcaagatgatcatataattgttgcagaatctttcaataca
aacaatttacaaaatgttgtagatagcgatcgcatttctattatccaaccaaaatcagat
attcctcagcttgaaactatttcccaaagtgggataatctcagcagagacaacgaatcaa
ttagaagcgactaatgagccaacagtaattcagaggttatcagatctagcaaatcctaca
gaggatttgaccttgcctacggttttacaaaatcttggacaaacagaacctttagttaag
ttctcatccttaacaaacgagcaacccaatcaccagattactacgaataatctgtctaat
ttatctagtaattctaatccatctagccagtctaatttgtctaactcgtctcgtctgtct
caattactgcaagcaaaaggcaatagttctactttgtctagctcaacaaataagatatcg
actacacctacttcaattcagccaaaacttgaccaaaatcagaataatgatgctcaagag
gcgaaatctcctagctggtcaaatattgcggaattgttagcaaagatgccacctcctaag
gtctctagtaacccctcaactaattcgctgaacaaaaaagcagttagctctagcgatcgc
agttctttggcaagccaacccaaatccattactacaagtacatctaaaagtacatctaat
cagacaattattcagcgatcgcccgatgatcgtaatgatgacgatttagatctctacatc
actcctacaggtttacaaagaggtaatcccaatcaagttactaatagtcaagttaatcct
attcaacgtaaaaaagaccctcatcaagataatgaaaacttaccagaagcaacagtttct
gtgaataatttccaagataatgacaataaagatgaggcaaattttgaagaaaatctcacg
gcacttgcccaagaaatttacgttttgttacggcaacgcctagaaatcgaaaaggagaga
caaggatcgatatatcgaggtcgattgccttggtaa

DBGET integrated database retrieval system