KEGG   Pseudomonas sp. StFLB209: PSCI_0318Help
Entry
PSCI_0318         CDS       T03623                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
pses  Pseudomonas sp. StFLB209
Pathway
pses00220  Arginine biosynthesis
pses00250  Alanine, aspartate and glutamate metabolism
pses00290  Valine, leucine and isoleucine biosynthesis
pses01100  Metabolic pathways
pses01110  Biosynthesis of secondary metabolites
pses01130  Biosynthesis of antibiotics
pses01210  2-Oxocarboxylic acid metabolism
pses01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pses00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSCI_0318
   00290 Valine, leucine and isoleucine biosynthesis
    PSCI_0318
   00220 Arginine biosynthesis
    PSCI_0318
Enzymes [BR:pses01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PSCI_0318
    2.6.1.66  valine---pyruvate transaminase
     PSCI_0318
Amino acid related enzymes [BR:pses01007]
 Aminotransferase (transaminase)
  Class I
   PSCI_0318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: BAP41020
UniProt: A0A077L9L4
LinkDB All DBs
Position
360280..361491
Genome map
AA seq 403 aa AA seqDB search
MQFSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPDEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKQVEGVGIEDIYLGNGVSELIVMSMQALLNNGDE
VLIPAPDYPLWTAAVSLAGGNPVHYLCDEQANWWPDLADIKAKITPNTKAMVIINPNNPT
GAVYPKEVLSGMLELARQHNLVVFSDEIYDKILYDEAVHISTASLAPDVLCLTFNGLSKS
YRVAGFRSGWLAISGPKHAAQSYIEGIDILANMRLCANVPSQHAIQTALGGYQSINDLVL
PPGRLLEQRNRTWELLNDIPGVSCVKPMGALYAFPRIDPKVCPILNDEKFALDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEQAIGRIGNFLKNYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcagcaaatcgaacaagctcgccaacgtctgctacgacattcgcgggccggtg
ctcaagcacgccaagcgtctggaagaggaaggccatcgcatcctcaagctgaacatcggc
aacccggcgccattcggtttcgaagccccggacgaaattcttcaggacgtgatccgcaac
ctgccgactgcccagggctacagtgactccaagggcctgttcagcgcccgtaaagcggtc
atgcagtactaccagcagaagcaggtcgaaggtgtcggtatcgaagacatctacctgggc
aacggcgtgtccgagctgatcgtgatgtcgatgcaggcgctgctcaacaatggcgacgaa
gtgctgatcccggcgccggactacccgctatggaccgccgccgtgagcctggccggtggc
aacccggtgcactatctgtgcgacgagcaggccaactggtggccggatctggccgacatc
aaggccaagatcaccccgaacaccaaagccatggtgatcatcaaccctaacaacccgacc
ggtgcggtctaccccaaagaagtgctgtcaggcatgcttgagctggcccgccagcacaac
ctggtggtgttttccgacgagatctacgacaagatcctctatgacgaagccgtgcacatc
agcaccgcctcgctggccccggacgtgctgtgcctgaccttcaacggcctgtccaagtcg
tatcgcgtggcaggtttccgctccggctggctggccatctccggtccgaagcatgccgcc
cagagttacatcgaaggcatcgacatcctggccaacatgcgcctgtgtgccaacgtaccg
agccagcatgcgatccagaccgcgctgggcggctaccagagcatcaacgacctggtgctg
ccacctggccggctgctggagcagcgtaaccgtacctgggagctgctcaacgacatcccg
ggcgtcagctgcgtcaaaccgatgggtgcgctctacgcgttcccgcgcatcgacccgaag
gtctgcccgattctcaacgatgaaaagttcgcgcttgacctgctgctctcggaaaagctg
ctgatcgttcagggcaccgcgttcaactggccatggccggatcacttccgcgtagtgacc
ctgccgcgggtcgatgacctggaacaggcgatcgggcggatcggcaacttcctcaagaat
tatcgccagtaa

DBGET integrated database retrieval system