KEGG   Pseudomonas sp. StFLB209: PSCI_0514Help
Entry
PSCI_0514         CDS       T03623                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pses  Pseudomonas sp. StFLB209
Pathway
pses00473  D-Alanine metabolism
pses00550  Peptidoglycan biosynthesis
pses01100  Metabolic pathways
pses01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pses00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PSCI_0514 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PSCI_0514 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PSCI_0514 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pses01011]
    PSCI_0514 (ddl)
Enzymes [BR:pses01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PSCI_0514 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:pses01011]
 Precursor biosynthesis
  Amino acid ligase
   PSCI_0514 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: BAP41216
UniProt: A0A077LBQ2
LinkDB All DBs
Position
complement(573833..574924)
Genome map
AA seq 363 aa AA seqDB search
MKKSVAIMFGGQSSEHEVSLQSARNVINAIDRGRYDLTLIGIDKQGRWLRFDESDYLVNP
GDPARIALSTAGRPLALLPGSTGGQLLDVESGQALARIDVVFALIHGAFGEDGALQGLLR
MLAIPFVGPDVLGSAACMDKDVTKRLLRDAGIDVAPFVVVQRGESIGFAEVSAQLGLPMF
IKPASQGSSVGVSKVTDAAGFQAALALAFEYDHKVLIEQGMSGREVECAVLGNREPQASV
CGEVVANDEFYAYDTKYLNDGQARTDIPAQLSEELAGRVREVALRAYRVLGCAGLSRVDF
FVTDQGDIAINEINTIPGFTSISMYPKLWQASGLTYAGLIDRLIDLALERGAEAALLKRD
ISL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaatcagtcgccatcatgttcggcggtcagtcgagcgagcatgaagtgtcgttg
cagtcggcacgcaacgtcatcaacgccatcgaccgtggccgctacgacctgaccctgatt
ggcatcgacaagcaaggccgctggctgcgcttcgatgaaagcgattatctggtcaaccca
ggtgacccggcgcgtatcgcactgagcacggccggccgccccttggcgttactgcctggc
agtaccggcgggcaattgctggatgtcgaatccggccaggccctggcgcgcatcgatgtg
gtgtttgcgctgattcacggcgcctttggtgaagacggcgcgttgcaaggcctgttgcgc
atgctggcgatcccgttcgtgggcccggatgtgctgggttcggcagcgtgcatggacaag
gacgtgaccaagcggctgttgcgcgatgccgggatcgacgtcgcgccgttcgtggttgtg
caacgtggtgagagcatcggttttgcggaggtaagcgcgcaactgggcttgccgatgttc
atcaagccggccagccaggggtcttcggttggggtcagcaaggtcaccgatgcagccggc
ttccaggccgcgctggcgctggccttcgagtacgatcacaaggtgctgatcgagcaaggc
atgagcggccgtgaagtggaatgtgcggtgctcggcaatcgggagccgcaggccagtgtc
tgtggtgaagtggtcgccaacgatgagttctacgcctacgacaccaagtacctcaatgac
ggccaggcacgcaccgacattcctgcgcaactgagcgaagaattggccgggcgggtccgt
gaagtggcgctgcgggcttaccgggtactgggctgtgccggtctgtcgcgggtggatttc
ttcgtcaccgatcagggcgacattgcgatcaacgagatcaataccatcccgggtttcacc
tcgatcagcatgtatcccaaactgtggcaggccagcggcctgacctatgccgggctgatt
gaccgtttgattgacctggcgctggaacggggtgcagaggctgctctgttgaaacgggat
atcagcctgtga

DBGET integrated database retrieval system