KEGG   Pseudomonas sp. StFLB209: PSCI_1192Help
Entry
PSCI_1192         CDS       T03623                                 

Gene name
tuf_2
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pses  Pseudomonas sp. StFLB209
Brite
KEGG Orthology (KO) [BR:pses00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pses03012]
    PSCI_1192 (tuf_2)
   03029 Mitochondrial biogenesis [BR:pses03029]
    PSCI_1192 (tuf_2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pses04147]
    PSCI_1192 (tuf_2)
Translation factors [BR:pses03012]
 Eukaryotic Type
  Elongation factors
   PSCI_1192 (tuf_2)
 Prokaryotic Type
   PSCI_1192 (tuf_2)
Mitochondrial biogenesis [BR:pses03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PSCI_1192 (tuf_2)
Exosome [BR:pses04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PSCI_1192 (tuf_2)
  Exosomal proteins of breast cancer cells
   PSCI_1192 (tuf_2)
  Exosomal proteins of colorectal cancer cells
   PSCI_1192 (tuf_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: BAP41894
UniProt: A0A077LJ77
LinkDB All DBs
Position
complement(1295812..1297005)
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAKVDFDKIDSAPEEKARG
ITINTAHVEYDSSVRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSALMALN
GQDDNEMGTSAVKKLVETLDSYIPEPERAIDKTFLMPIEDVFSISGRGTVVTGRVERGIV
RIQEEVEIVGLRDTTKTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLAKPG
TIKPHTKFVAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
QMEVTLIKPIAMEDGLRFAIREGGRTVGAGVVAKIIA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaagaaaaatttgaacgtaacaaaccgcacgtcaacgttggcaccatcggtcac
gttgaccacggtaaaaccactctgaccgctgctctgactcgcgtttgctccgaggttttc
ggttcggctaaagtcgacttcgacaaaatcgacagcgcgccagaagaaaaggctcgtggt
atcaccatcaacactgctcacgtagagtacgactcttctgttcgtcactacgcgcacgtt
gactgcccaggtcacgccgactacgtcaaaaacatgatcactggtgctgcccagatggac
ggcgcgatcctggtttgctcggctgccgatggcccgatgccacaaactcgtgagcacatc
ctgctgtcccgtcaggttggcgttccgtacatcgttgtcttcctgaacaaggctgacatg
gttgacgacgctgagctgctggaactggtcgagatggaagttcgcgacctgctgagcacc
tacgacttcccaggtgatgacactccaatcatcatcggttcggctctgatggctctgaac
ggccaagacgacaacgaaatgggtacttcggctgtcaagaagctggttgagactctggac
agctacatcccagagcctgagcgtgctatcgacaagaccttcctgatgccaatcgaagac
gtgttctcgatctccggtcgtggcaccgtggtaactggtcgtgttgagcgtggtatcgtt
cgcatccaggaagaagttgaaatcgttggtctgcgtgacaccaccaagaccacttgcacc
ggcgttgaaatgttccgcaagctgctggacgaaggccgtgctggtgagaactgcggcgtt
ctgctgcgtggcaccaagcgtgacgacgttgagcgtggtcaggttctggccaagccaggc
accatcaagcctcacaccaagttcgtagctgaagtctacgttctgagcaaggaagagggt
ggtcgtcacactcctttcttcaaaggctaccgtcctcagttctacttccgtactactgac
gtaaccggtaactgcgaactgccagaaggcgttgagatggtgatgccaggtgacaacatc
cagatggaagtcaccctgatcaagccaatcgcaatggaagacggtctgcgtttcgccatt
cgtgaaggcggccgtaccgttggtgctggcgtcgttgcaaaaatcatcgcctaa

DBGET integrated database retrieval system