KEGG   Pseudomonas sp. StFLB209: PSCI_1911
Entry
PSCI_1911         CDS       T03623                                 

Gene name
tssL1
Definition
(GenBank) type VI secretion protein TssL1
  KO
K11892  type VI secretion system protein ImpK
Organism
pses  Pseudomonas sp. StFLB209
Pathway
pses03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pses00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSCI_1911 (tssL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pses02044]
    PSCI_1911 (tssL1)
Secretion system [BR:pses02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSCI_1911 (tssL1)
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: BAP42613
UniProt: A0A077LI82
LinkDB
Position
2097528..2098817
AA seq 429 aa
MHSNDDRTQFMPRPGGRPAPSSAPAPQPPSEASGPALAAGQGDGLNPLEAAAGPLLALLT
RLRNTIAHPAPASLRAQLLAQLRQFEERADAAGVARNDVLLARYVLCTALDEAVMSTPWG
SASEWGKQSLLVTVHNENWGGEKSFQLLEHCLQTPRERLYLLELLYLCMSLGFEGKYRVM
NNGRSQLEALRERTSAAIRSARGEREQELSPRWRGLVLARDRLAQFMPPWVGVAIGVALL
LLLLLGLRMKLANDAEPVFKRIHALGEIPVQAIDRPVIQPKVVERPRLAGFLADEIRAGK
VAVQDAVDRSVVTIRGDELFASGSATIVDAYQPLMLRIAEAVSKVKGEVRITGHSDNRPI
ATLRFPSNWALSQARAEQVLQILAARTGQPQRFTAEGRSDTEPVASNATTEGRAKNRRVE
ITVLAEGVE
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgcattcgaacgacgatcgcacccagttcatgccgcgcccgggcggccgcccggcgccc
tccagtgcgccggcaccacagccgccgagcgaagcctcaggtcctgccctggcggcgggt
cagggcgacggcctcaacccgctggaggcagccgccggtcctttgctggcgttgctgacc
cggctgcgcaataccatcgcccatccggcaccggccagtttgcgcgcccaactgctggcc
cagttgcgccagttcgaagagcgcgccgatgccgccggtgtcgcgcgtaacgacgtgctg
ctggcgcgttatgtgctgtgcacggcccttgatgaagcggtgatgagtactccgtggggc
agcgccagtgagtggggcaagcagagcctgctggtcaccgtgcataacgaaaactggggc
ggcgaaaagtcctttcagttgcttgagcactgcctgcaaacgccgcgtgaacgtttgtac
ctgctggaactgctgtacctgtgcatgagcctgggttttgaaggcaagtatcgggtcatg
aacaacggccgcagccagcttgaagccctccgcgagcgcaccagtgcggcgattcgcagt
gcccgtggcgagcgtgagcaagagctgtcgccgcgctggcgtggtttggtgctggcccgt
gaccggctggctcagttcatgccgccttgggtcggtgtggcgattggcgtggcgctgctg
ttgctgctgctgttgggcttgcggatgaagctggccaatgacgcggagccggtgttcaag
cgcattcatgcgctgggcgaaatcccggtgcaggccatcgaccggccagtgattcagcca
aaggtggtcgagcgtccacgcctggccggctttctggctgacgagattcgcgccggcaag
gttgctgtgcaagacgccgtagaccgttcggtggtgaccattcgcggtgacgaactgttc
gcctccggcagcgcaaccattgtcgatgcctatcagccgctgatgctgcgtatcgccgag
gcggtgagcaaggtcaagggcgaggtgcgcatcaccgggcatagcgacaaccgacccatc
gccaccctgcgttttccgtccaactgggcgctgtcccaggcccgtgccgagcaagtgctg
caaatcctcgccgcacgcaccggccagccgcagcgcttcacggccgaaggccgcagtgac
accgagccggtggcctccaatgccaccaccgaaggacgggcgaagaatcgccgggttgaa
atcaccgtactggcggagggcgtcgagtga

DBGET integrated database retrieval system