KEGG   Pseudomonas sp. StFLB209: PSCI_1915Help
Entry
PSCI_1915         CDS       T03623                                 

Definition
(GenBank) serine/threonine-protein kinase PpkA
  KO
K11912  serine/threonine-protein kinase PpkA [EC:2.7.11.1]
Organism
pses  Pseudomonas sp. StFLB209
Pathway
pses02025  Biofilm formation - Pseudomonas aeruginosa
pses03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pses00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSCI_1915
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSCI_1915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pses01001]
    PSCI_1915
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pses02044]
    PSCI_1915
Enzymes [BR:pses01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PSCI_1915
Protein kinases [BR:pses01001]
 Serine/threonine kinases: Other
  Bacterial family
   PSCI_1915
Secretion system [BR:pses02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PSCI_1915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal VWA_2 TssR VWA Kinase-like Kdo
Motif
Other DBs
NCBI-ProteinID: BAP42617
UniProt: A0A077LF17
LinkDB All DBs
Position
2103710..2106802
Genome map
AA seq 1030 aa AA seqDB search
MDMQIPGFDIEGEIGEGAMATVYLAIQRSLERKVALKVMAASLAADPSFCERFLREGRTL
ARLAHPHIATIHDIGNVGPLYYMAMEYLPAGTLKERIAAGLSDEQGLLYIRQIAAALGYA
HAQGLVHRDVKPANILFRADGTAVLSDFGIAKSLDDRTQFTQAGFAVGTPSYMSPEQARG
QEIDGRADLYALGVVFYEILAGRLPYSGPDALSTALAHLTEPLPELPVQHGRYQHVLTRL
LAKDPAERFANAQVLVAALDELIQSDSERTLLRPLPVVDTLPGNEPVSEAATDELAGLTP
VSIVIPDSPPPAAAEPVNRPAPNLSKSRARPALQDQPPRRGPAMALLAVAIAAALGIGAG
GYLWLSADKPAAAQGGAASATPQAAATAAPTPASTPATATPALNAAQQPATDTGKPLLMA
GKQTLYQRVLSKPGARFASEPGGNVDKPLPAFSVLYVYERRQANGEPWLRVGAGSDGRSE
GWLPASQVSDWKQSLVLKFTERSGRSPVMFLRDPGKLESLIADPVAARKLLMQAQNDTQD
NSQVLALEPAASAVPQDQFYLLPIFDSRESFDEDGQPVQMLNIASIDPGNLPQKTAGDQP
RSAGASNAFRTAVVLVVDTSVSMQPYIDQVREVVHQLQDKIAQRGELDSVSFGLVGFRNN
TSKTPGLQYLSKTLITLEQGRDPQRFLELARQVKATPVSSHSFNEDAFAGIMQAVDGMDW
SGYGGRLILLVSDAGALRKSDPLSSTRMNEAEVRQAALGKQIKIYALHLRTEAGKKNHDS
AEQQYRVLTADPNPRIGDLYVPVAGGDVQQFGERVGEIGSVFADLVHQVRSNQPQAVPLL
AKAPSLSEKSAAVGYAMHMDFLGRKAAIQAPQLVSAWAADRDLTNPALPAFQVCVMLTKL
QLNDLQQSLKLIVDAARKTQTSPKDFFQEIASASAYMSRDPQALRNGANLAAGGVLGEYL
EGLPYRSKSLNMTQDLWLSLSVAEQEDFIDELESKIRLYETFHNDLANWVRFGDAEPGDA
LYRVPLSTLP
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atggacatgcaaattcctggattcgacattgaaggcgaaattggcgaaggcgcgatggct
acggtgtatctggccatccagcgttcgctggagcgcaaggtagcgctcaaggtcatggcc
gccagcctggctgccgacccgagcttctgcgagcgcttcctgcgcgaaggccgcaccctg
gcgcggctggcgcatccgcacattgcgaccattcacgacattggcaacgtcggcccgctg
tactacatggccatggagtatctgcccgccggcacgcttaaagaacggatcgcggccggg
ctttcagatgagcaggggctgctgtacatccgccagatcgccgccgcgttgggctacgcc
catgcccagggtctggtccaccgcgacgtaaaaccggccaacatcctgttccgcgccgat
ggcaccgcggtattgtcggacttcggcatcgctaaatcactggacgaccgcacccagttc
acccaggccggatttgccgtgggcacgccgagttacatgagcccggaacaggctcgcggc
caagaaatcgacggccgcgccgacctttatgcgctgggcgtagtgttctacgagattctg
gccgggcgcctgccgtatagcggcccggatgcgttatccacagcactggcgcacctgacc
gaaccgctgccggaactgccggtgcagcatggccgctaccagcacgtactgacccgcctg
ctggccaaagacccggccgagcggtttgccaatgcccaggtgctggtcgcggcgctggac
gaactgattcagagcgacagtgaacgcaccctgctgcgtcctttaccagtggtcgatacc
ctgccgggtaatgagccggtcagcgaagccgcgaccgatgagctggccgggctgacgcca
gtgtccatcgtgattcctgacagcccgccaccggcagcggcagagccggtcaaccgcccc
gcgccgaatctgagcaaatcccgggcgcgcccggcgttgcaggatcaaccgccccgtcgc
ggccccgccatggccttgctggcggtggcgattgccgccgcactgggtatcggtgctggt
ggttatctctggctgagcgctgacaagcccgccgctgcccaaggcggcgccgcgtcggcc
acgccccaggctgcagccaccgcagcgccgacgcctgcaagcacgccagccaccgcaacg
ccggccctcaatgccgcgcaacaaccggcaaccgataccggcaagccgttgctgatggca
ggcaagcagaccctctatcaacgggtgctgagcaagcccggtgcgcggtttgccagtgag
cctggtggcaatgtcgataaaccgctgccggccttctcggtgctgtatgtctacgagcgc
cgccaggcaaacggtgagccgtggctgcgggtcggtgcgggcagtgacgggcgcagtgaa
ggctggctgccggccagccaggtcagcgactggaagcagagtctggtgctcaagttcact
gaacgctccgggcgctcgccggtgatgttcctgcgtgatcccggcaaactggaaagcctg
attgccgatccggtagcggcgcgcaagctgttgatgcaggcgcagaacgacactcaggac
aacagccaggtactggccctggaaccggctgccagcgctgtgccgcaggaccagttctac
ctgctgccgatttttgattcgcgggaaagcttcgacgaagacggtcagccggtacagatg
ctcaacattgcctcgatcgaccccggcaacctgccgcaaaagaccgctggcgatcagccc
agatccgcaggggccagcaatgcatttcgtacggcggtggtactggtagtcgatacctcg
gtgtcgatgcagccgtacatcgatcaggtccgtgaagtcgtccatcaattgcaggacaag
atcgcccagcgcggtgagctggacagcgtcagctttggcctggtgggctttcgcaacaac
accagtaagactcccggcttgcaatacctgagcaagaccctgatcaccctggagcagggc
cgcgacccgcagcgcttcctggaactggcccggcaggtcaaggccacgccagtgtccagc
cattcattcaatgaagacgccttcgccgggatcatgcaggcggtcgatggcatggactgg
tccggctacggcgggcggctgatcctgctggtcagcgatgccggtgcgttgcgcaagagc
gacccgctcagcagcacccggatgaacgaagccgaagtgcgtcaggccgcactgggcaag
cagatcaaaatctacgcgctgcatctgcgcaccgaggctggcaagaaaaatcacgattcg
gccgaacagcagtatcgggtcctgaccgccgacccgaacccgcgcattggcgacctctat
gtgccggtggccggtggtgatgtgcagcagttcggcgagcgggttggcgagatcggctcg
gtgttcgccgatttggtgcaccaggtgcgcagcaaccagccgcaagcggtaccgctgctg
gccaaggcgcccagcctgagtgagaaatccgccgccgtcggttacgccatgcacatggat
tttctcggtcgcaaagcggcgatccaggcgccgcagttggtcagtgcctgggccgctgac
cgagacctgaccaacccggcgctgccggcctttcaggtctgcgtgatgctcaccaaactg
caactcaacgacctgcagcaatcgctgaagctgatcgtcgatgcggcgcgcaagacccag
acttcacccaaggatttcttccaggaaatcgccagtgccagcgcttacatgagccgcgac
ccgcaagccttgcgcaacggcgccaacctggccgctggcggggtgttgggcgaatacctt
gaagggctgccgtaccgcagcaagtcgctgaacatgacccaggatttgtggttgtcgttg
agcgtggccgagcaggaggactttatcgacgagctggaatcgaagatccgcctctacgag
accttccacaacgatctggccaactgggtccgcttcggcgatgccgagccgggtgatgcg
ctgtaccgcgtaccgttgtcgacgctgccgtga

DBGET integrated database retrieval system