KEGG   Pseudomonas sp. StFLB209: PSCI_2173Help
Entry
PSCI_2173         CDS       T03623                                 

Definition
(GenBank) ferredoxin, 4Fe-4S
Organism
pses  Pseudomonas sp. StFLB209
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_2 Fer4_16 Fer4_9 Fer4_10 GF_recep_IV Fer4_21 Fer4_4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: BAP42875
UniProt: A0A077LEF2
LinkDB All DBs
Position
complement(2395398..2395649)
Genome map
AA seq 83 aa AA seqDB search
MSLIITDDCINCDVCEPECPNEAISQGEEIYVIDPNLCTECVGHYDEPQCQQVCPVDCIP
LDENRVESKDELMTKYRLITGKA
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgtcccttatcatcactgacgattgcatcaactgcgacgtctgcgaaccagagtgcccg
aacgaagcgatttcccagggcgaagaaatctacgtgatcgaccccaacctgtgcaccgag
tgcgtgggccactacgacgagccgcaatgccagcaagtctgcccggtcgattgcatcccg
ctggatgaaaaccgggtcgaaagtaaagacgagctgatgaccaaataccggctcatcacc
ggtaaagcctga

DBGET integrated database retrieval system