KEGG   Pseudomonas sp. StFLB209: PSCI_3759Help
Entry
PSCI_3759         CDS       T03623                                 

Gene name
ligD
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pses  Pseudomonas sp. StFLB209
Pathway
pses03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pses00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    PSCI_3759 (ligD)
Enzymes [BR:pses01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PSCI_3759 (ligD)
DNA repair and recombination proteins [BR:pses03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PSCI_3759 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: BAP44461
UniProt: A0A077LK70
LinkDB All DBs
Position
4211147..4213645
Genome map
AA seq 832 aa AA seqDB search
MVSEYTRKRRFDITREPPETGTRSKRKAAGEALSFAIQKHDASHLHYDLRLELDGTLKSW
AVPKGPSLDPAHKRLAVQVEDHPLAYASFEGRIPEGQYGAGEVIVWDRGIWQPHGDPRKG
YEAGKLEFTLIGEKLNGEWALVRTRLKGSGNRKQWLLIKRSDDAARPVDEFDITVERPDS
VLSDATLSRTRPARPEQPKKNTAFVHTLSPQLATLIDRPPPGDWLYEIKYDGYRILTCIH
AGEVRLLSRTGNDWTARMQRLAKALARLGLEDSWLDGEVVVLDRDGLPDFQALQRAFDEH
SDAQIVYYLFDAPWLNGDDLRKQPLQARREALAQVLEGQRSKLIRFSAGFAASHHDIVES
ARAMGLEGVIGKRAGSLYQGKRSADWIKLKCRLAQEFVIVGYTPPEGSRSGFGALLLAVN
DARAAGLVYAGRVGSGFDGKTLRQLKQQLDALQRDSSPLCKPLSRELSRDVHWVEPQLVA
EVQFAEWTRDALLRQASFIGLRTDKPAAQVLREVARRAALPLVDEAQPDSSEQATKACVA
GVAISHPERVIDPQSGVSKAVLAQFYLAIADRLLAELSKRPVALLRCPQGIEGEQFFQKH
AQRLSIPNITQLDASLDPGHAPLLQIDNRAALAGVVQMGGVELHTWGATSDRIETPDRLI
FDLDPDPALPWCSMIEATQMLLAVLDELGLQAFLKTSGGKGMHLIVPLARHTGWDQVKRF
GKAVAEFMSRQLPERFSATAGPQNRVGRIFIDYLRNTRGGTTVSAWSVRARPGLPVSVPV
GRDELATLSSARQWHVGNLAEHLRDLDEDPWAGYHNRQRITQAMWRQLGIDD
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atggtcagcgagtacacccgcaagcgccgtttcgatatcacccgcgaaccgccagagacc
ggcacccgcagcaagcgcaaggccgctggagaggcgcttagctttgcgatccagaagcac
gacgccagtcacttgcactacgacttgcgtcttgaactggacggtactctgaaaagctgg
gcggtacccaaaggcccgagcctggacccggcacacaagcgcctggcagtgcaggtcgaa
gaccacccgctggcgtacgccagctttgaagggcgtattcccgaagggcagtatggtgcc
ggtgaggtcattgtctgggatcgcggtatctggcagccgcacggtgatccgcgcaagggg
tatgaagctggcaagctggaattcaccctgatcggggaaaaactcaatggcgagtgggcg
ttagtgcgcacccggctcaagggcagcgggaatcgcaagcaatggctgctgatcaagcgc
agcgacgatgcggcgcggccggtcgatgaatttgatatcaccgtcgagcgccccgacagt
gtcttgagtgacgccaccctcagccgaacccggccggccaggcctgagcagccgaaaaaa
aacacagcctttgtacacacgttgagcccgcaactggccaccctgatcgaccgaccgccg
cccggcgactggctgtatgagatcaagtacgacggctatcgcatcctgacctgcatccac
gccggtgaagtgcgcctgctgagtcgtaccggcaatgactggacagcacggatgcaaagg
cttgccaaggcgctggccaggctggggcttgaagacagctggctcgacggcgaggtggtg
gttctcgatcgtgacggcttgccggattttcaggcgttgcaacgggcatttgatgagcac
agcgatgcacagatcgtttactacctgtttgatgcgccctggctcaatggcgatgacctg
cgcaagcagccgctgcaagcgcggcgtgaggctctggcccaagtgcttgaaggtcagcgc
agcaaattgatcagattctccgcaggctttgccgccagtcatcacgacattgtcgagagt
gcaagggccatgggcctggaaggggtcattggcaaacgtgctggcagtctctaccagggc
aagcgcagtgctgactggatcaagctcaaatgccgtctggctcaggagtttgtgatcgtc
ggctacacaccgcccgagggtagccgtagtggtttcggcgcgttgttgctggcggtcaat
gatgccagggcggcaggattggtgtacgccgggcgggtcggcagcggctttgacggcaag
acgctgcgccagctcaagcaacagcttgatgcattgcagcgtgacagctcgccgttatgc
aagccgctcagtcgtgagttgagccgcgatgtgcactgggttgaaccgcagctggtcgcc
gaggtgcagtttgccgaatggacccgagatgcgcttttgcgtcaggcctcgttcatcggc
ttgcgtaccgataagccggcggcgcaggtgctgcgtgaggtcgcccgccgagcagctctg
ccgttggtggatgaggcgcagccggactcctcagagcaggccactaaagcctgcgtcgcc
ggcgtcgcgatcagtcaccctgaacgggtcattgatccgcaaagcggcgtcagcaaggcc
gttctggcgcagttctatctggccattgccgaccggctgctggctgagctgagcaaacgt
ccggtcgcgttgctgcgttgcccgcaaggcatcgagggcgagcaatttttccagaaacat
gcccagcgcttgagcatcccgaatatcactcaacttgacgcgtctctggaccccggtcat
gcgccgctgctgcagatcgataaccgggcagcgctggccggtgtggtgcagatgggggga
gtcgagttgcatacctggggcgctaccagtgaccggattgaaactccggaccggctgatc
ttcgatctcgatcccgatccggcgctgccgtggtgcagcatgatcgaggccacccagatg
ctcctggcggtgctcgatgagctgggcctgcaggcctttctgaaaaccagcggcggcaag
ggcatgcacctcattgtgccgctggcccggcacaccggttgggatcaggtgaagcgcttt
ggcaaggcggtcgccgaattcatgagtcgccagttgcccgaacgcttcagcgctacggcc
ggcccacagaaccgggtcgggcggatctttattgactatctgcgcaatacccgcggcggc
actacggtgtcggcctggtcagtgcgcgcccgacctggcctgcccgtgtcagtgcctgtc
ggtcgcgatgaactggcgaccctgagctcggcccggcaatggcacgtcggcaacctggcg
gagcacttgcgcgatctggacgaagatccatgggcgggctatcacaatcgccagcgcatt
actcaggcgatgtggcgacagttgggtattgatgattga

DBGET integrated database retrieval system