KEGG   Pseudomonas sp. StFLB209: PSCI_3998Help
Entry
PSCI_3998         CDS       T03623                                 

Definition
(GenBank) trehalose synthase/maltokinase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pses  Pseudomonas sp. StFLB209
Pathway
pses00500  Starch and sucrose metabolism
pses01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pses00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSCI_3998
Enzymes [BR:pses01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PSCI_3998
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PSCI_3998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap
Motif
Other DBs
NCBI-ProteinID: BAP44700
UniProt: A0A077LJ85
LinkDB All DBs
Position
4479839..4483270
Genome map
AA seq 1143 aa AA seqDB search
MPKSKSKSQKTRSASFINDPLWYKDAVIYQVHVKSFFDSNDDGIGDFPGLIAKLDYIAGL
GVNTLWVLPFYPSPRRDDGYDIAEYRAVHPDYGSMADAKRFISEAHKRGLRVITELVINH
TSDQHPWFQRARHAKPGSKARNFYVWSDTDQKYEGTRIIFLDTEKSNWTWDPVAGQYFWH
RFYSHQPDLNFDNPQVMDAVLGVMRFWLDLGVDGLRLDAIPYLIERDGTNNENLPETHQV
LKRIRAEIDANYPDRMLLAEANQWPEDTQMYFGDVKGGDIKGGDVKGGDIKGGDVKGGDS
NGADGDECHMAFHFPLMPRMYMALAQEDRFPITDILSQTPAIPANCQWAIFLRNHDELTL
EMVTDRERDYLWNHYAADRRARINLGIRRRLAPLVERDRRRIELLNSMLLSMPGTPTLYY
GDELGMGDNIYLGDRDGVRTPMQWSIDRNGGFSRADPASLVLPPIMDPLYGFQSVNVETQ
DRDPHSLLNWTRRMLAVRKQQKAFGRGALNLLSPNNRRILAYTREYTGTDGHTEIILCVA
NMSSAAQAVELDLSAYAGMVPVEMLGGSAFPPIGQLTYLLTFAPYGFHWFLLAAENQMPS
WHVEPAQSMPDFPTLVLKKRLEELLEQPLRGTIENTSLAVYLPKRRWFASKDKPIDKVNI
AHAVRFSDGLRPVLLSEIEVTAGGQTERYQLPFGLLAEDDISSALPQQLALARVRRGAQV
GLITDAFTLEPFIRNLVQAMQDGTVIDSGEGDLQFKATARLEPLGLDQESTVRYLSAEQS
NSSVVVGEALVLKMIRKVSAGVHPELEMGAYLTAAGYPNISPLLGSLQRIGTEGQPHLLM
IAQGYLDNQGDAWEWTQNNLERAVRDELTRRTASQEQAYNALAELADFSRTLGQRLGEMH
QVLAAPTDNPDFATENTGTKEAQATAKRVQAQLDHSLKLLEQRRESLQPADWLLVEQLLT
RRKALDKHVQTLAKASVGGLRMRVHGDLHLGQVLVVKGDAYLIDFEGEPVRALDERRGKY
SPFKDVGGVLRSFDYAAAMAVRSAQSADTSAEAIAAREHVASEYLRQARESFLEGYRKAT
QGLAHAWQDPQGEAAALELFTLEKTAYEVIYEAENRPDWLAVPLQGLWQGLRGLLELNDG
ESK
NT seq 3432 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagtcgaagtcaaagtcgcaaaaaacgcggtccgccagcttcatcaacgacccg
ctctggtacaaggatgcggtgatctaccaagtccacgtcaagtcgttcttcgactccaac
gatgacggcatcggggactttccaggcctgatcgccaagctcgattacatcgccgggctg
ggggtcaataccctgtgggtgttgccgttctatccttcgccgcggcgcgatgacggctac
gacattgccgagtatcgggctgtgcatcctgactacggcagcatggccgatgccaagcgc
tttatcagtgaggcgcacaagcgcgggctgcgggtgatcaccgaactggtgatcaaccac
acctccgaccagcatccgtggttccagcgcgcccggcatgccaagcccggctccaaagcg
cgcaacttctatgtgtggtccgacactgaccaaaagtacgagggcacgcggatcatcttt
ctcgacaccgagaaatccaactggacctgggacccggtggccggtcagtacttctggcac
cgattttattctcatcagccagacctgaatttcgataacccgcaggtgatggacgcggtg
ctcggggtgatgcgcttctggctcgacctgggggtggacggcttgcgcctggacgccatc
ccgtacctgatcgagcgcgatggtactaacaacgaaaacctgcccgagacccatcaggtg
ctcaagcgcatccgcgctgaaatcgacgccaattatcccgaccggatgctgctggccgag
gccaatcagtggcctgaagacacgcagatgtactttggtgacgtgaagggcggtgatatc
aagggcggtgacgtgaagggcggtgatatcaagggcggtgacgtaaagggcggcgacagc
aacggcgccgacggcgatgagtgccatatggcctttcatttcccgctgatgccgcgcatg
tacatggcgctggctcaggaagaccgcttcccgatcaccgatatcctcagccagacgccg
gcgattcctgccaactgtcagtgggcaatcttcctgcgcaatcacgatgagctgaccctg
gagatggtcaccgaccgcgagcgtgactacctgtggaaccactatgccgctgaccgccgg
gcacggatcaacctgggcattcggcggcgtcttgcgccactggtggagcgcgatcggcgg
cggatcgaactgctcaacagcatgctgttgtcgatgccgggcacgccgactctgtattac
ggtgatgagctgggcatgggtgacaatatctatctgggcgaccgcgacggggtgcgtacc
cccatgcagtggtcgattgaccgcaatggcggcttttcccgcgccgacccggccagcctg
gtattgccgccaatcatggacccgttgtacggctttcagtcggtcaatgtcgagactcag
gaccgtgacccgcattcattgctgaactggacccggcgcatgctggcagtacgcaaacaa
caaaaagccttcggccgtggtgcgctgaacctgttgtcgcccaacaaccgacggattctg
gcctacacccgggaatacaccggtaccgacggacacaccgagatcattttgtgcgtcgcc
aacatgtccagcgccgcccaggcggtggagctggacttgtcggcctacgccggcatggtg
ccggtggaaatgctcggcggcagtgcgtttccgcccattggccagctcacttacctgctg
acctttgccccctacgggtttcattggtttctactcgctgcggagaatcaaatgcccagt
tggcacgttgaaccggcgcagagcatgccggacttcccgaccctggtactcaagaaacgt
ctggaagagctgctcgaacaaccgctgcgcggcaccatcgaaaacacttcgctggcggtc
tacttgcccaagcggcgctggttcgccagcaaagacaagcccatcgacaaggtcaatatc
gcccatgcggtgcgcttctctgacgggctgcggccggtgctgctcagtgaaatcgaggtg
actgctggcggccagaccgagcgctaccagttgccgttcggcctgttggccgaggacgac
atcagcagcgccttgccccagcaattggccctggctcgggtgcggcgcggtgctcaggtc
ggcctgatcaccgatgccttcaccctggagcccttcatccgtaacctggttcaggcgatg
caggacggcaccgtgatcgacagcggcgagggcgacttgcagttcaaggccaccgcccgg
cttgagccgctgggccttgatcaggagtcgaccgtgcgctatttgtcggccgagcaatcc
aacagctcggtggtggtgggcgaagcgttggtgctgaagatgatccgcaaggtcagcgcc
ggtgttcacccggaactggaaatgggcgcctacttgacggccgccggctacccgaacatt
tcaccgctgctcggctcgctgcagcgcatcggcacggagggtcagccacacctgctgatg
atcgcccaaggctatctggacaatcagggcgatgcctgggaatggacccagaacaacctg
gagcgtgcggtgcgcgacgagctgacgcggcgcaccgccagccaggagcaggcttataac
gccttggccgaactggccgatttttcccgtaccctgggtcagcgactcggtgagatgcat
caggtgttggcggcgccgactgacaaccccgatttcgccaccgaaaacacgggcaccaaa
gaagcgcaggccacagccaaacgggtgcaggcccaactcgaccattccctgaaattactc
gagcagcgccgcgaaagtttgcaacctgccgattggctgttggtcgaacagctgctcacc
cgtcgtaaagcgctggataaacacgtccagaccctggccaaggcctctgtgggcgggctg
cgcatgcgggtccacggcgacctgcatctgggtcaggtgctggtggtaaaaggagatgca
tacctgatcgactttgaaggcgagccggtgcgtgcgctggatgagcgccgtggcaaatac
agccctttcaaggatgttggcggcgtactgcgttcgttcgactacgctgcggcgatggcc
gtgcgcagcgcgcagagcgcggacacctcggcagaggcgattgcggcgcgtgagcatgtg
gcgagtgagtatctgcgtcaggcccgcgagtcgtttcttgagggctatcgcaaggcgacc
caaggcctggcgcatgcctggcaagacccgcagggagaggcggcagcgctggaactgttt
acgctggaaaaaactgcatacgaagtgatctacgaagccgagaatcgcccggattggttg
gccgtacctttgcaagggttatggcaagggctacgtgggttgctggaattgaacgatgga
gagtcgaaatga

DBGET integrated database retrieval system