KEGG   Pseudomonas sp. StFLB209: PSCI_4390Help
Entry
PSCI_4390         CDS       T03623                                 

Gene name
ahpF-2
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pses  Pseudomonas sp. StFLB209
Brite
KEGG Orthology (KO) [BR:pses00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSCI_4390 (ahpF-2)
Enzymes [BR:pses01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PSCI_4390 (ahpF-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored Glutaredoxin AlaDh_PNT_C DAO NAD_binding_8 Thi4 K_oxygenase FAD_binding_3 FMO-like
Motif
Other DBs
NCBI-ProteinID: BAP45092
UniProt: A0A077LMA8
LinkDB All DBs
Position
4901834..4903396
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKSYLERATRPIEIQASLDDGAKSQEMLALLQDVVSVGKDITLATDGNDAR
RPSFTLNSPGQDISLRFAGIPMGHEFTSLVLALLQAGGYPPKVSDEVIEQVRALQGEFSF
ETYFSQSCQNCPDVVQALNLMAVLNPNIKHVAIDGALFQDEVTERKVMSVPSIYLNGELF
GQGRMGLEEILAKIDTGAGARQAEKLNAKQAFDVLVIGGGPAGSAAAVYSARKGIRTGVA
AERFGGQVLDTMAIENFISVQHTEGPKLAVALEEHVKQYEVDIMNLQRADQLIPGKDGAL
HEVKFASGASLKAKTLILATGARWREMNVPGEKEYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLLEFDGQLRADAVLQRKLNSLPNVTVLTSAQTTEVTGDGE
KVNGLRYKDRVSGEERAVELEGIFVQIGLLPNSEWLKGVIELSPRGEIVVDARGETSVPG
IFAAGDVTVTPYKQIIIALGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaaatcctatctggagcgggccactcgcccc
atcgagatccaggcctccctcgacgacggcgccaagtctcaggaaatgctcgcgctgctg
caagatgtagtcagcgtcggcaaagacattaccctggccactgacggtaacgatgcgcgc
aggccgtcgttcaccctcaatagcccaggccaggacatcagcttgcggtttgccggtatc
ccgatggggcacgaattcacctcgctggttctggcgctgctgcaagcaggcggctacccg
cccaaagtcagtgatgaggtcatcgaacaagtgcgcgccctgcaaggcgagttcagtttc
gaaacctatttttcccagtcctgccagaactgcccggacgtggtccaggcactgaacctg
atggccgtgctcaacccgaacatcaagcacgtcgccatcgacggcgcactgttccaggat
gaagtcaccgagcgcaaagtcatgtcggtgccaagcatttacctcaacggtgagttgttt
ggtcagggccgtatgggcctggaagagattctcgccaaaatcgacaccggtgccggtgcg
cgccaggccgagaagctcaacgccaaacaagccttcgacgtgctggtgattggtggtggc
ccggctggctccgccgcagcggtctactcggcacgtaaaggcattcgtaccggcgttgcc
gccgagcgtttcggcggtcaggtgctcgacaccatggcgatcgaaaactttatctcggtc
cagcacaccgaaggcccgaagctggcggttgccctcgaagagcacgtcaagcagtacgaa
gtcgacatcatgaacctgcaacgcgctgaccagctgattccaggcaaggacggcgcgctg
cacgaggtgaagtttgccagtggtgcgagcctcaaagccaagaccctgatcctggcgacc
ggtgcgcgctggcgggaaatgaacgtccccggcgagaaggagtatcgcaacaagggcgtg
gcgtactgcccgcactgtgacggtccactgttcaagggtaagcgtgtggcagtgatcggt
gggggcaactccggtgtggaagcggccatcgacctggccggtatcgtctcccacgtaacg
ctgttggagtttgacggccagctgcgagctgacgcggtgctgcaacgcaagctcaatagt
ttgcccaacgtcaccgtgctgaccagtgcacagaccactgaagtgaccggcgacggcgag
aaggtcaatggcctgcgctacaaggaccgggtcagcggcgaagagcgtgcggtggaactg
gaagggatctttgtacagatcggtctgctgcctaacagcgagtggctcaaaggcgtgatc
gagctgtcgccgcgcggcgagatcgtggtcgatgcccgcggtgaaacctcggtgccgggt
atttttgcggccggtgacgtcactgtcacgccgtacaagcagatcatcatcgccctgggc
gaaggtgccaaagcgtcgctgagtgctttcgatcacctgatccgcaccagcgcgccagcc
tga

DBGET integrated database retrieval system