KEGG   Pseudomonas sp. StFLB209: PSCI_4977Help
Entry
PSCI_4977         CDS       T03623                                 

Gene name
accC2
Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
pses  Pseudomonas sp. StFLB209
Pathway
pses00061  Fatty acid biosynthesis
pses00620  Pyruvate metabolism
pses00640  Propanoate metabolism
pses01100  Metabolic pathways
pses01110  Biosynthesis of secondary metabolites
pses01120  Microbial metabolism in diverse environments
pses01130  Biosynthesis of antibiotics
pses01200  Carbon metabolism
pses01212  Fatty acid metabolism
Module
pses_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pses00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSCI_4977 (accC2)
   00640 Propanoate metabolism
    PSCI_4977 (accC2)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PSCI_4977 (accC2)
Enzymes [BR:pses01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PSCI_4977 (accC2)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PSCI_4977 (accC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C ATP-grasp_3 LAL_C2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: BAP45679
UniProt: A0A077LS42
LinkDB All DBs
Position
5610196..5611551
Genome map
AA seq 451 aa AA seqDB search
MFDTVLIANRGEIALRIQRACHQLGLKTVMVYSQGDAGAAYLQHADQALCIGPAAPGQSY
LDSRAVIYAALASGAQAVHPGYGFLSENAAFSQAVSDAGLTFIGPDAACIRRMGDKVAAK
RAMLEAGVPCVPGPQGALPEERERIEAIALEIGYPVIIKAAGGGGGRGMRVVHSAAELLP
AVSLTREEARRAFGNPELYMEKFLGHPRHVEIQVLCDRHGNGVWLGSRDCSLQRRHQKVL
EEAPAPGIDAQALAQVGQRCVEACRLIGYQGVGTFEFLYEDGEFFFIEMNTRLQVEHPVT
EMTTGIDIVEQQLRVAMGEVLSLRQSDIVTQGHALECRINAEDPQTFIPTPGTVTRWDLP
GGIGVRIDSHVCAGDKVPPYYDSMIAKVITHGATREQALARMRTALAQFAVEGISTNLPL
HRQILTDNAFVAGSVDIHHLERWLSTRQAES
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgttcgataccgttctgatcgccaaccggggcgaaatcgccctgcgcattcagcgcgcc
tgtcatcaactgggcctgaagaccgtgatggtctactcccaaggcgatgccggcgcggcc
tatctgcaacatgccgaccaggcgctgtgcatcggtcctgcggcccccggacaaagctat
ctggacagtcgggctgttatttatgccgcgctggccagtggtgcccaggccgtgcatccg
ggctatggctttttgtcggagaacgccgccttcagccaggccgtgagcgatgccggcctg
accttcatcggcccggacgccgcgtgcatccggcgcatgggcgacaaggtggcggccaaa
cgcgccatgcttgaggccggcgtaccctgcgtacccggcccacaaggggcgctgcccgag
gagcgcgagcgcattgaagcgattgccctggagatcggctacccggtgatcatcaaggct
gccggcggcggtggtggccggggcatgcgtgtggtgcacagtgccgccgagctgctgcct
gccgtcagcctgacccgcgaagaagcccgccgcgcctttggcaaccccgagctgtacatg
gagaaatttctcggccacccccgccatgtcgagatccaggtgttgtgcgaccgccacggt
aacggtgtgtggctgggcagccgcgactgctcgctgcaacgtcgtcaccagaaggtgctg
gaagaggcaccggcaccgggtatcgatgcccaggcactggcgcaggtgggccagcgctgc
gttgaagcctgccgcctgatcggctatcagggtgtgggcaccttcgagtttctctatgaa
gacggcgagttctttttcatcgagatgaacacccgcctgcaagtcgagcacccggtcacc
gagatgaccaccggcatcgacatcgtcgaacagcaactgcgcgtggccatgggtgaagtg
ctcagcctgcgccaatccgacatcgtcacccaggggcacgctctggaatgccggatcaac
gccgaagacccgcaaaccttcatcccgacccccggcacggtgacccgctgggacctgccg
gggggtatcggcgtgcgtatcgactcgcatgtgtgcgcaggcgacaaggtgccgccctac
tacgactcgatgatcgccaaggtcattacccacggcgccacccgcgaacaggcgctggcc
cgcatgcgtaccgccctggcgcagtttgcggtcgagggcatcagcaccaacctgccgctg
caccggcagatcctcaccgacaacgcctttgtcgccggtagcgtggacattcatcacctg
gagcgctggctgagcacacgccaggcggagagctga

DBGET integrated database retrieval system