KEGG   Pseudomonas sp. StFLB209: PSCI_5126Help
Entry
PSCI_5126         CDS       T03623                                 

Definition
(GenBank) large subunit of terminal oxygenase component of anthranilate 1,2-dioxygenase
  KO
K05599  anthranilate 1,2-dioxygenase (deaminating, decarboxylating) large subunit [EC:1.14.12.1]
Organism
pses  Pseudomonas sp. StFLB209
Pathway
pses00627  Aminobenzoate degradation
pses01100  Metabolic pathways
pses01120  Microbial metabolism in diverse environments
Module
pses_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:pses00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PSCI_5126
Enzymes [BR:pses01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     PSCI_5126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Ring_hydroxyl_A
Motif
Other DBs
NCBI-ProteinID: BAP45828
UniProt: A0A077LRG4
LinkDB All DBs
Position
5790666..5792066
Genome map
AA seq 466 aa AA seqDB search
MNQTRSVDQWKAFINGCLDFRPVEGVFRIARDMFTEPELFDLEMELIFEKNWIYACHESE
IANKHDFMTMRAGRQPMIITRDGEGQLHALINACQHRGTTLTRVMKGNQSTFTCPFHAWC
YKSDGRLVKVKAPGEYPEGFDKATRGLKKARIESYEGFVFISLDAQGTDSLEDFLGDSKV
FFDMMVAQSPSGELEVLPGKSTYSYDGNWKLQNENGLDGYHVSTVHYNYVATVQHRQQVN
AEKGNASSTLDYSKLGAGDAQTDDGWFSFHNGHSLLFSDMPNPTVRPGYATVMPRLVEAY
GQAKAEWMMHRLRNLNIYPSLFFMDQISSQLRIVRPVAWNKTEIISQCIGVKGESDADRE
SRIRQFEDFFNVSGMGTPDDLVEFREAQRGFQARLERWSDISRGHGKWVEGPTANSEAIG
IQPVLTGTEFTHEGLYVNQHNNWQRFLLEGLDKQACEQDALKLREV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagacaagaagcgtcgaccagtggaaagccttcatcaatggctgcctggatttt
cgccccgtagagggcgtgttccgcatcgcccgtgacatgttcacggaaccggagttgttc
gacctggagatggaactgatcttcgagaagaactggatctacgcctgccacgagagcgag
atcgccaacaagcacgacttcatgaccatgcgtgccggccgccagccgatgatcatcacc
cgtgacggtgaaggtcagttgcacgcgctgatcaacgcctgccagcaccgcggcaccacc
ctgacccgggtgatgaagggcaaccagagcaccttcacctgcccgttccacgcgtggtgc
tacaagagcgacggccggctggttaaggtcaaggcgcccggcgaatacccggaaggcttc
gacaaggccacccgcggcctgaaaaaggcgcgcatcgaaagctacgagggctttgtgttc
atcagcctagacgctcagggcaccgacagcctggaggatttcctcggcgattcgaaggtg
ttcttcgacatgatggtcgctcagtcgccaagcggtgagctggaagtgctgccgggcaaa
tcgacctacagctatgacggcaactggaagctgcagaatgagaatggcctggacggctat
cacgtcagcaccgtgcactacaactacgtggccaccgtgcagcaccgccagcaagtcaat
gctgaaaaaggcaacgccagcagcaccctggactacagcaagctcggcgccggcgatgcg
cagaccgacgacggctggttctcgtttcataacggccacagcctgctgttcagcgacatg
cccaaccccacagtgcgccccggctacgccacggtgatgccacgtctggtcgaggcctac
ggccaggccaaagccgagtggatgatgcaccgcctgcgcaatctgaacatctacccaagt
ctgttcttcatggaccagatcagttcgcagttgcgcatcgtacgtccagtggcctggaac
aagaccgagatcatcagccagtgcatcggcgtgaaaggcgaatccgacgccgatcgcgag
agccggattcgtcaattcgaagactttttcaacgtctcgggcatgggcacgccggatgac
ctggtggagttccgtgaagcccagcgcggcttccaggcgcgcctggaacgctggagcgat
atttcccgcggccacggcaaatgggttgaaggtccgaccgccaacagcgaagcgatcggc
atccagccggtgctgaccggcaccgaattcacccacgagggcctgtacgtcaaccagcac
aacaactggcagcgctttctgcttgaaggtctggacaagcaagcctgcgaacaagacgct
ttgaaactgcgcgaggtgtga

DBGET integrated database retrieval system