KEGG   Pseudomonas sp. TCU-HL1: THL1_1129Help
Entry
THL1_1129         CDS       T05373                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pset  Pseudomonas sp. TCU-HL1
Pathway
pset00473  D-Alanine metabolism
pset00550  Peptidoglycan biosynthesis
pset01100  Metabolic pathways
pset01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pset00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    THL1_1129
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    THL1_1129
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    THL1_1129
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pset01011]
    THL1_1129
Enzymes [BR:pset01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     THL1_1129
Peptidoglycan biosynthesis and degradation proteins [BR:pset01011]
 Precursor biosynthesis
  Amino acid ligase
   THL1_1129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp ATPgrasp_Ter RimK GARS_A ATP-grasp_5 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AOE83677
UniProt: A0A1B3E2B1
LinkDB All DBs
Position
1218580..1219527
Genome map
AA seq 315 aa AA seqDB search
MSAQLNSTYDPAAFGRVAVLYGGKSAEREVSLKSGTMVLQALQNAGVDAFGIDVGDDLLQ
RLQAQKIDRAFIILHGRGGEDGSMQGLLECLDIPYTGSGILASALAMDKLRTKQLWVSLG
LPTPRHAVLASEADCRQAAAELGFPLIVKPAHEGSSIGMAKVEGVEALIEAWRAAGVYDP
QVLVEQWIHGPEFTVAWLRGEVLPPIRLGTPHTFYDYDAKYLASDTRYQIPCGLDADKEE
ELKQLTARACETLGIQGWARADVMQDAEGCFWLLEVNTAPGMTDHSLVPMAARAAGLDFQ
QLVLAILADSVEARG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcaactgaactccacctacgacccggcagcgttcggtcgcgtcgccgtgctc
tacggcggcaagagcgctgagcgcgaggtctcgctgaagtccggcaccatggtgctccag
gctctgcagaacgccggcgtggacgcgttcggcatcgatgtcggcgacgacctgttgcag
cgcctgcaagcccagaaaatcgatcgcgctttcatcatcctccacggtcgtggtggcgaa
gacggcagcatgcagggcctgctggagtgcctggacattccgtacaccggcagcggcatc
ctggcttcggcactggccatggacaaactgcggaccaagcagctgtgggtcagcctgggc
ctgccgacgccccgccatgcggtactcgccagcgaagcggactgccgtcaggccgctgca
gaactgggcttcccgttgatcgtcaagccagcccacgagggctctagcatcggcatggcc
aaggtggagggcgtcgaggcgctcatcgaagcctggcgcgccgccggtgtctacgacccg
caagtgctggtggaacagtggatccacggtccggagttcaccgtcgcttggctgcgtggt
gaagtgctgccgcccatccgtctcggcaccccgcacaccttctacgactatgacgccaag
tacctggccagtgatacccgctaccagatcccctgtggactggatgcggacaaggaggag
gagctgaagcagctcaccgcgcgcgcctgcgaaaccctcggcatccagggctgggcccgt
gccgacgtgatgcaggacgccgaagggtgcttctggctcctcgaagtcaacaccgcaccg
ggcatgaccgatcacagcctggtgccgatggccgcacgcgctgcgggcctggatttccag
caactggtgctggcgatcctcgccgacagcgtcgaggcaaggggctga

DBGET integrated database retrieval system