KEGG   Pseudomonas sp. TCU-HL1: THL1_1345Help
Entry
THL1_1345         CDS       T05373                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pset  Pseudomonas sp. TCU-HL1
Brite
KEGG Orthology (KO) [BR:pset00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    THL1_1345
Enzymes [BR:pset01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     THL1_1345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO AlaDh_PNT_C FAD_oxidored FAD_binding_3 NAD_binding_7 Glutaredoxin K_oxygenase Thi4 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AOE83893
UniProt: A0A1B3E2Y8
LinkDB All DBs
Position
1454755..1456311
Genome map
AA seq 518 aa AA seqDB search
MLDANLKTQLKAYLEKVTQPFEIVASLDDSDKSRELLGLLQDIVGLTDKITLKTDGSDAR
RPSFSLNRPGAGISLRFAGIPMGHEFTSLVLALLQVGGHPSKLGTDVIEQISSIEGEFTF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRLVAIDGALFQDEVEQRQIMSVPSIYLNGELF
GQGRMGVEEILARIDTGAAARDAEKLNAKAAFDVLVIGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLARALEEHVKQYDVDIMNLQRAAALVPAKAEGE
LHEVRFESGASLKARTVILSTGARWREMNVPGEQEYRGRGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDDKLRADAVLQKKLASLPNVAVIKSALTTEVKGDG
QKVNGLVYKDRTTDELRTLELEGIFVQIGLLPNSEWLKGVVELSPRGEIIVDAKGQTNIP
GVFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTT
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaaacccagttgaaggcctacctcgaaaaggtcacccagccg
ttcgagatcgtcgcgtccctcgatgacagcgacaaatcccgcgagttgctcgggctgctg
caagacatcgtcggtctgaccgacaagatcaccctgaagaccgatggcagcgacgcccgt
cgcccgtcgttctccctgaatcgccctggcgccggtatttccttgcgcttcgccggcatc
cccatgggccacgagttcacctcgctggtgctggccctgctgcaggttggcggtcacccg
tccaagctgggtaccgatgtgatcgagcagatcagctccatcgaaggcgaattcacgttc
gaaacctatttctcgctgtcctgccagaactgccccgacgtggtgcaggcgctgaacctg
atggccgtgctcaacccgaacatccgcctcgtcgccatcgacggcgcgctgttccaggat
gaagtcgagcagcgccagatcatgtcggtgcccagcatttacctgaacggcgagctgttc
ggccagggccgcatgggcgtggaagaaatcctcgccaggatcgacaccggcgccgccgct
cgcgacgccgagaagctcaatgccaaggcagccttcgatgtgctggtgatcggcggtgga
cccgctggtgcctccgcagctatctatgccgcgcgcaagggcatccgcaccggcgtggcc
gccgagcgcttcggtggccaggtgctggacaccatggctatcgagaacttcatctccgta
caggaaaccgaaggcccgaaactggcccgagccctggaagagcacgtgaagcagtacgac
gtcgacatcatgaacctgcagcgcgctgcggcgctggttccggccaaggccgagggcgag
ctgcatgaagtgcgcttcgaaagcggtgcctcgctgaaggccaggaccgtgatcctctcc
accggcgcccgctggcgcgaaatgaatgtgcccggcgagcaggaataccgtggccgtggc
gtggcctactgcccgcactgcgacggtccgctgttcaagggcaagcgcgtggcagtgatc
ggcggcggtaactccggcgtcgaagcagccatcgacctggcgggtatcgtcgcccatgtc
accctgatcgagttcgacgacaagctgcgtgctgatgccgtgttgcagaagaagctggcc
agtctgccgaacgtcgccgtgatcaagagcgcgctgaccactgaggtgaaaggcgatggc
cagaaggtcaacggcctggtctacaaggaccgcaccactgacgagctgcgcaccctggaa
ctggaaggcatcttcgtgcagatcggcctgctgcccaacagcgagtggctgaagggcgtt
gtggagctgtccccgcgcggcgaaatcatcgtcgacgccaagggccagaccaacatcccc
ggcgtgttcgccgctggcgacgtgaccacggtgccgtacaaacagatcgtgatcgccgtg
ggcgagggtgccaaggcatcgctgagcgccttcgatcacctgatccgtacgacctga

DBGET integrated database retrieval system