KEGG   Pseudomonas sp. TCU-HL1: THL1_2076Help
Entry
THL1_2076         CDS       T05373                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
pset  Pseudomonas sp. TCU-HL1
Pathway
pset00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pset00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    THL1_2076
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pset01002]
    THL1_2076
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pset01011]
    THL1_2076
Enzymes [BR:pset01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     THL1_2076
   3.4.21  Serine endopeptidases
    3.4.21.-  
     THL1_2076
Peptidases and inhibitors [BR:pset01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   THL1_2076
Peptidoglycan biosynthesis and degradation proteins [BR:pset01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   THL1_2076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 SdpA DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: AOE84624
UniProt: A0A1B3E503
LinkDB All DBs
Position
complement(2247136..2248593)
Genome map
AA seq 485 aa AA seqDB search
MFKSIRTLALTALILPYALPLHAAQVNTSLPAKVQKALTANKISPNSLSLVTLPLTGPGS
QTLVNADLSVNPASTMKLITTYAALELLGPTYQWKTEFYSDGVLKNGVLNGNLYLKGGGD
PKLNMEKLWLMMRDLRANGVRQVTGDLVLDRSYFIHPQLPAFNDDGGDDNKPFLVGPDSL
LVNLKAVRLIARAEGGKVNLAMEPPIESIRIDNKVQVTKAGKCPSWPDVRYNPVTQYDGT
TLIASGKLPEGCSAQTYMSLLDHPGYAAGAVRAFWKELGGTINGKDRLGDVPKDAKLLAR
SFSPDLVEVIRDINKYSNNTMAQQLFLSIGARYRTDADGDDAKAAQRVIRNWLAKKGITA
PHLVMENGSGLSRHERVSAREMAAILQAAWQSPYAAEFVSSLPLVAMDGTMRKRLRRTPL
EGEAHIKTGTLNTVRAIAGFSRDSNGNTWAVVAILNDSRPWGASAILDQVLVDLYRQPKS
VAGAN
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagtcgatccgtaccctcgcactcactgccctgatcctgccctacgccctaccg
ttgcatgcggcacaggtcaacaccagcctgcccgccaaggtgcaaaaggcgctgactgcc
aacaagatttcccccaactcgctgtccctggtgacgctgccgctcaccggcccgggctcc
cagacgctggtcaacgccgacctttcggtgaatccggcatccaccatgaagctgatcacc
acctacgccgccctggaactgctgggcccaacctaccagtggaagaccgagttctactcc
gatggcgtcctgaagaacggcgtactcaacggcaacctctacctcaagggcggcggcgat
cccaagctgaacatggagaaactctggctgatgatgcgcgacctgcgcgccaacggcgtg
cgccaggtcaccggcgacctagtgctggaccgcagctactttatccatccgcaactgccc
gccttcaacgatgacggcggcgacgacaacaaacccttcctggtcggccccgactcgctg
ctggtcaacctcaaggccgtgcgcctgatcgcccgcgccgaaggtggcaaggtcaacctg
gccatggagccaccgatcgagagcatccgcatcgacaacaaggtgcaggtgaccaaggcc
ggcaagtgcccgtcttggcccgatgtgcgctacaacccggtgacccagtacgacggcacg
acgctgatcgccagcggcaaactgcctgaaggctgcagcgcccagacctacatgtccctg
ctcgaccatccgggctacgccgccggtgcggtgcgcgcattctggaaggagctgggcggc
accatcaacggcaaggatcgcctgggcgacgtccccaaggacgccaagctgctggcgcgg
tccttctcgccggacctggtggaagtcatccgcgacatcaacaagtacagcaacaacacc
atggcccagcagttgttcctcagcataggtgcgcgttaccgcactgatgccgatggcgac
gacgccaaggccgcgcagcgggtaatccgcaactggctggcgaagaaaggcattaccgcg
ccgcacctggtgatggagaacggctccggcctgtcgcgccatgaacgggtcagcgcccgg
gaaatggccgccattctccaggccgcctggcagagcccctatgctgccgagttcgtctcc
tcgctgccgctggtggcgatggacggcaccatgcgcaagcgcctgcgccgcacgccgctg
gaaggcgaagcccacatcaagaccggaaccctgaacacggtgcgagccatcgctggcttc
agccgcgacagcaatggcaacacctgggccgttgtagccatcctcaatgactcgcgcccc
tggggcgcatcggcaatcctcgaccaagtgctggtagacctctaccgccagccgaagagc
gtcgccggagccaactga

DBGET integrated database retrieval system