KEGG   Pseudomonas sp. TCU-HL1: THL1_2175Help
Entry
THL1_2175         CDS       T05373                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pset  Pseudomonas sp. TCU-HL1
Pathway
pset00020  Citrate cycle (TCA cycle)
pset00190  Oxidative phosphorylation
pset00650  Butanoate metabolism
pset01100  Metabolic pathways
pset01110  Biosynthesis of secondary metabolites
pset01120  Microbial metabolism in diverse environments
pset01130  Biosynthesis of antibiotics
pset01200  Carbon metabolism
Module
pset_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pset_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pset_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pset00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    THL1_2175
   00650 Butanoate metabolism
    THL1_2175
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    THL1_2175
Enzymes [BR:pset01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     THL1_2175
    1.3.5.4  fumarate reductase (quinol)
     THL1_2175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA DAO FAD_binding_3 HI0933_like Thi4 Pyr_redox_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AOE84723
UniProt: A0A1B3E5A3
LinkDB All DBs
Position
2353043..2354815
Genome map
AA seq 590 aa AA seqDB search
MASIRTLSFDAIIVGGGGAGMRAALQLAQGGHKTAVVTKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPEAVFELEHMGLPFSRTEQGRIYQRP
FGGQSKDFGKGGQAARTCAAADRTGHALLHTLYQANLKSGTAFLNEWYAVDLVKNQDGAV
VGIIAICIETGETVYIRSKAVVLATGGAGRIYASTTNALINTGDGVGMALRAGVPVQDIE
MWQFHPTGIAGAGVLVTEGCRGEGGYLINAHGERFMERYAPNAKDLAGRDVVARSMVKEV
IAGNGVGPNKDHVLLKLDHLGEDVLHSRLPGICELSKTFAHVDPVVAPIPVIPTCHYMMG
GVATNIHGQAITQDANGNDTIVEGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRAAGLH
LEKALKEGIEVRGASETDLELSLKRLSGVNERTSGEEVAPLKRELQQCMQNYFGVFRTGE
YMQKGITQLADLRERIAQVKISDKSQAFNTARIEALELQNLLEVAEATAIAAEVRKESRG
AHAREDFEDRDDENWLCHTLYFPGEKRVTKRAVNFAPKTVPAFEPKVRTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggctagcattcgtactctttcttttgacgccatcatcgtaggtggcggcggcgccggc
atgcgtgctgcgctgcaactggcccagggcggccacaaaactgccgtggtgaccaaggtc
ttcccgacccgctcccacaccgtttctgcccagggtggcatcacctgtgccatcgcttcg
gccgacccgaacgacgattggcgctggcacatgtacgacaccgtcaagggttccgactac
atcggtgaccaggatgccatcgaatacatgtgctccgtcggtccggaagccgtgttcgag
ttggagcacatgggtctgccgttctcccgtaccgagcagggccgcatctatcagcgcccg
ttcggcggccagtccaaggacttcggcaagggtggccaggctgcccgtacttgcgctgcg
gccgaccgtaccggtcacgccctgctgcacaccctgtaccaggccaacctgaagagcggc
accgcgttcctcaacgagtggtacgccgttgacctggtgaagaaccaggatggcgccgtc
gtcggtatcatcgccatctgcatcgaaaccggtgaaaccgtctacatccgctccaaggcc
gtggttctggccactggcggtgctggtcgaatctacgcctccaccaccaacgccctgatc
aacactggcgacggcgtgggcatggccctgcgcgctggtgtgccggtgcaagacatcgaa
atgtggcagttccacccgaccggtatcgccggtgccggtgttctggtgaccgaaggttgc
cgtggcgagggtggctacctgatcaacgcccatggcgagcgcttcatggagcgttatgct
ccgaacgccaaggatctggctggccgcgacgtggttgcccgttccatggtcaaggaagtg
atcgccggtaacggcgtgggcccgaacaaggaccacgtgctgctgaagctcgaccacctg
ggcgaagacgttttgcacagccgcctgcccggcatctgcgaactgtccaagaccttcgcg
cacgtcgatccggtcgtcgcgccgatccctgttattccgacctgccactacatgatgggc
ggcgttgccaccaacattcacggtcaggccatcacccaggacgccaacggcaacgacacc
atcgtcgaaggcctgttcgccgtgggtgaggtcgcttgcgtgtcggttcacggcgccaac
cgcctgggcggcaactcgctgctcgacctggttgtgttcggccgcgctgccggtctgcac
ctggagaaggcgctcaaggaaggtatcgaggtgcgtggcgccagcgagaccgatctcgag
ctgtccctcaagcgtctgtccggcgtgaacgagcgcaccagcggcgaagaagtcgccccg
ctgaagcgcgagctgcagcagtgcatgcagaactacttcggtgtgttccgtaccggcgaa
tacatgcagaagggtatcacccagctggccgatctgcgcgagcgtatcgctcaggtcaag
atctccgacaagtcccaggccttcaacaccgcgcgtatcgaagcgctggagctgcagaac
ctgctggaagttgccgaagccaccgcgatcgccgcagaagtccgtaaagagtcccgtggt
gcacacgcccgcgaagacttcgaagatcgcgatgacgagaactggctgtgccacaccctg
tacttcccgggtgagaagcgcgttaccaagcgcgctgtcaacttcgcgccgaagaccgtt
ccggcgttcgaacccaaagtgcgtacttattaa

DBGET integrated database retrieval system