KEGG   Pseudomonas sp. TCU-HL1: THL1_2176Help
Entry
THL1_2176         CDS       T05373                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pset  Pseudomonas sp. TCU-HL1
Pathway
pset00020  Citrate cycle (TCA cycle)
pset00190  Oxidative phosphorylation
pset00650  Butanoate metabolism
pset01100  Metabolic pathways
pset01110  Biosynthesis of secondary metabolites
pset01120  Microbial metabolism in diverse environments
pset01130  Biosynthesis of antibiotics
pset01200  Carbon metabolism
Module
pset_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pset_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pset_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pset00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    THL1_2176
   00650 Butanoate metabolism
    THL1_2176
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    THL1_2176
Enzymes [BR:pset01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     THL1_2176
    1.3.5.4  fumarate reductase (quinol)
     THL1_2176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: AOE84724
UniProt: A0A1B3E5A8
LinkDB All DBs
Position
2354827..2355543
Genome map
AA seq 238 aa AA seqDB search
MSNTLTVSVYRYNPERDSAPTMQDFQVDTDGKDVMVLDVLALIKEQDEGFSYRRSCREGV
CGSDGMNINGKNGLACITPLSAAGLKGGKLVIRPLPGLPVIRDLVVDMSIFYKQYEKVKP
FLQNDTPAPAIERLQSPEEREKLDGLYECILCACCSTSCPSFWWNPDKFLGPAALLQAYR
FLADSRDNKTEERLAALDDPFSVFRCRGIMNCVSVCPKGLNPTKAIGHVRNMLLQSGT
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacactctcactgtcagcgtctatcgctacaacccggagcgcgatagcgctccg
accatgcaggatttccaggtcgacaccgacggcaaggacgtgatggtcctcgacgtgctg
gcgctgatcaaggaacaggacgagggtttctcctaccgtcgttcctgccgtgaaggcgtt
tgcggttccgacggcatgaacatcaacggcaagaacggcctcgcgtgcatcacgccgctg
tccgctgccggccttaagggtggcaagctggtgattcgcccgctgccgggcctgccggtc
atccgtgacctggtcgtcgatatgagcatcttctacaagcagtacgagaaggtgaaaccc
ttcctgcagaacgatactccggccccggccatcgagcgtctgcagtctccggaagagcgc
gaaaagctcgacggtctgtacgagtgcatcctgtgcgcttgctgctcgacttcctgcccg
tccttctggtggaaccccgacaagttcctcggtcccgctgcgctgctgcaggcctaccgt
ttcctggccgacagccgtgacaacaagaccgaagagcgactggccgcactggacgacccg
ttcagcgtgttccgttgccgcggcatcatgaactgcgtgagcgtttgcccgaagggtctg
aacccgaccaaggcgatcggccacgtacgcaacatgctgctgcagagcggtacctga

DBGET integrated database retrieval system