KEGG   Pseudomonas sp. TCU-HL1: THL1_2178Help
Entry
THL1_2178         CDS       T05373                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pset  Pseudomonas sp. TCU-HL1
Pathway
pset00020  Citrate cycle (TCA cycle)
pset00310  Lysine degradation
pset00380  Tryptophan metabolism
pset01100  Metabolic pathways
pset01110  Biosynthesis of secondary metabolites
pset01120  Microbial metabolism in diverse environments
pset01130  Biosynthesis of antibiotics
pset01200  Carbon metabolism
Module
pset_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pset_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pset00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    THL1_2178
  09105 Amino acid metabolism
   00310 Lysine degradation
    THL1_2178
   00380 Tryptophan metabolism
    THL1_2178
Enzymes [BR:pset01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     THL1_2178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AOE84726
UniProt: A0A1B3E5A9
LinkDB All DBs
Position
2358660..2359877
Genome map
AA seq 405 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGDAVKRDELIVDIETDKVVMEVLAEADGVLAEIV
KNEGDTVLSGELLGKLNAGAAAAAPAAAAPAAAPAAQAAAPAAADDAILSPAARKLAEEN
GIDANSIAGTGKGGRVTKEDVVAAVEAKKSAPAAAAKPAAPAGEAPIFAAGDRVEKRVPM
TRLRAKVAERLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKTHNGVRLGFMSFFVK
ASVEALKRFPAVNASIDGSDIVYHGYQDIGVAVSSDRGLVVPVLRNAELMSLAEVESGIA
TFGKKARDGKLSIDEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNIIQRPMAING
QVVIRPMMYLALSYDHRLIDGKEAVSFLVTIKNLLEDPARLLLDI
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagcccccactttcccggaatcggttgccgacggcaccgtggct
acctggcacaagaagccgggcgatgcggtcaagcgcgacgagctgatcgtcgacatcgaa
accgacaaagtggtcatggaagtcctggcggaagccgacggcgtcctggctgaaatcgtc
aagaacgagggcgacaccgtcctcagcggcgaactgctgggcaagctgaacgctggcgcc
gctgctgccgccccggccgctgctgctcctgctgccgctcccgctgcccaggctgctgcc
ccggctgctgctgacgacgccatcctctctccggccgcccgtaagctggccgaagagaat
ggcatcgacgcgaacagcattgccggcaccggcaagggcggtcgtgtgaccaaggaagac
gtggttgccgccgtggaagccaagaagtccgctccggccgccgctgccaagccggccgcc
ccggctggcgaggcgccgatcttcgccgcgggtgaccgcgtcgagaagcgcgtaccgatg
acccgcctgcgtgccaaggtcgccgagcgcctggtcgaagcccagtcgaacatggcgatg
ctgaccaccttcaacgaagtggacatgaccgaagtcatggccctgcgttcgaagtacaag
gacctgttcgagaagacccacaacggcgtgcgcctgggcttcatgtcgttcttcgtcaag
gcttccgtcgaagcgctgaagcgtttcccggcggtcaacgcttcgatcgatggttccgac
atcgtctaccacggctaccaggacatcggcgttgccgtatccagcgaccgtggcctggtg
gtaccggtacttcgcaatgccgagctgatgagcctggccgaagtcgaaagcggcatcgct
accttcggcaagaaggcgcgtgacggcaagctgtcgatcgatgaaatgaccggtggcacc
ttcaccatcaccaacggcggtacgttcggttcgatgatgtcgaccccgatcgtcaacccg
ccgcaggcagccatcctcggcatgcacaacatcattcagcgcccgatggccatcaacggt
caggtcgttatccgcccgatgatgtacctggccctgtcctacgatcaccgcctgatcgat
ggcaaggaagcggtcagtttcctggtgaccatcaagaacctgctggaagacccggctcgt
ctgctgctggacatctga

DBGET integrated database retrieval system