Pseudomonas sp. TCU-HL1: THL1_2512 Help Entry THL1_2512         CDS       T05373                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism pset  Pseudomonas sp. TCU-HL1 Pathway pset00362   Benzoate degradation pset00621   Dioxin degradation pset00622   Xylene degradation pset01100   Metabolic pathways pset01120   Microbial metabolism in diverse environments pset01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:pset00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     THL1_2512    00622 Xylene degradation     THL1_2512    00621 Dioxin degradation     THL1_2512 Enzymes [BR:pset01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      THL1_2512 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 CinA_KH Motif Other DBs NCBI-ProteinID:  AOE85060 UniProt:  A0A1B3E694 LinkDB All DBs Position complement(2712365..2712571) Genome browser AA seq 68 aa AA seqDB search MPFVNVRITRDGVTREQKAQVIAEITETLQRVLGKRPDLTHIVIEEVDTDNWGYAGMTTT EYRKQQPG NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgcctttcgtcaacgtacgcatcacccgcgacggcgtgacccgcgagcagaaagcccag gtcatcgccgaaatcaccgaaaccctgcaacgggtcctgggcaagcgcccggacctgacg cacatcgtgatcgaggaagtcgacaccgataactggggttatgccgggatgaccactacc gagtaccgcaaacagcagcccggctga

DBGET integrated database retrieval system