KEGG   Pseudomonas sp. TCU-HL1: THL1_2972Help
Entry
THL1_2972         CDS       T05373                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pset  Pseudomonas sp. TCU-HL1
Pathway
pset00473  D-Alanine metabolism
pset01100  Metabolic pathways
pset01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pset00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    THL1_2972
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    THL1_2972
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pset01011]
    THL1_2972
Enzymes [BR:pset01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     THL1_2972
Peptidoglycan biosynthesis and degradation proteins [BR:pset01011]
 Precursor biosynthesis
  Racemase
   THL1_2972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DUF4454
Motif
Other DBs
NCBI-ProteinID: AOE85520
UniProt: A0A1B3E7K1
LinkDB All DBs
Position
complement(3205797..3207035)
Genome map
AA seq 412 aa AA seqDB search
MTRHTLSRLAIALAIAGSAGLSHAAPLLDATRDNAPAAARMAESNAWLEIDHAAFESNID
RIQKLVAGKSQVCAVMKADAYGTGIALLVPSAIRMGIECIGVASNEEARIVREKGFKGRL
MRLRTASLGEMEDALPYRMDEMVGNLEVARQLDALAHRNGRKLAVHLALNSAGMGRNGLE
VGTAQGRKDAVEMATLPYLKVVGIMTHFPVEEREDVLQGLARFKEQSTWLIEQAKLDRSK
VLLHCANTFTTLEVPEGWLDMVRPGAALYGYPVGGHDEFQRVMQFKSQVASVNAYQAGSS
ISYDRTYTLTRDSLIANIPAGYSDGYRRAFSNRASVLINGQRARVIGKVTMNTLMVDVTD
IQGVKPGDEVVLYGKQGKDEITQAELEAINGALLADLYTVWGNSNPKVLKAE
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgacccgacacaccctgagccgcctggccatcgccctggccatcgccggcagcgccggc
ctctcccacgcagcccccctactggacgccacccgcgacaacgcacccgccgccgcgcgc
atggccgaaagcaatgcctggctggaaatcgaccatgccgccttcgagagcaacatcgac
cgcatccagaaactggtggctggcaagagccaggtctgcgcggttatgaaggccgatgcc
tatggcaccggcatcgccctgttggtgccttcggccatccgcatgggcatcgaatgcatc
ggcgtcgccagcaacgaagaagcccgcatcgtccgggaaaagggcttcaagggccgcctg
atgcgcctgcgcaccgccagcctgggcgagatggaagacgccctgccctaccggatggac
gaaatggtcggcaacctggaagtcgcccgccagctggacgccctggcccaccgcaatggc
cgcaagctggcggtgcacctggcgctgaattcggccggcatgggccgcaacggcctggaa
gtgggcacggcccagggccggaaagatgcggtcgagatggccaccctgccttatctgaag
gtggtcggcatcatgacgcacttcccagtggaagagcgcgaggacgtgctccaaggcctc
gcccgcttcaaggagcagtccacttggctgatcgagcaagcgaagctggatcgcagcaag
gtcctgctgcactgcgccaataccttcaccaccctggaagtccccgaaggctggctggac
atggtccgccccggcgccgcgctgtatggctacccggtgggcggccacgatgagttccaa
cgggtcatgcagttcaaatcgcaggtggcctcggtcaacgcctatcaggccggcagcagc
atcagttacgaccgcacctacaccctgacccgggattcactcattgccaacattcccgcc
ggctactcggacggctaccgccgcgcgttctccaacagggcctcagtgctgatcaacggg
cagcgggcgcgggtgatcggcaaggtcaccatgaacaccctgatggtcgacgtcaccgac
atccagggggtgaaacccggcgatgaagtggtgctctacggcaagcaaggcaaggacgag
atcacccaggccgagctggaagccatcaacggcgcgctgttggcggacctctacacggtc
tggggcaattcgaatccgaaggtattgaaagcggagtga

DBGET integrated database retrieval system