KEGG   Pseudomonas sp. TCU-HL1: THL1_4519Help
Entry
THL1_4519         CDS       T05373                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pset  Pseudomonas sp. TCU-HL1
Pathway
pset00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pset00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    THL1_4519
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pset02000]
    THL1_4519
Enzymes [BR:pset01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     THL1_4519
Transporters [BR:pset02000]
 Other Transporters
  Pores ion channels [TC:1]
   THL1_4519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AOE87067
UniProt: A0A1B3EBZ5
LinkDB All DBs
Position
4887709..4888350
Genome map
AA seq 213 aa AA seqDB search
MTPQNRQVTLYHCPYTRSTGALTLLEELGADYKLHVMNMKLGEQRQPEFLAINPMGKVPT
LTHGDAVVTEQVSVYLYLADLYPEARLAPPLGDPLRGPYLRWMVFYGSCFEPAVVDRVQQ
REPIPEARSPYGDFDSVMKTLVAQLQKGPWLLGEQFTAADVLWGSALNWTTQFGLIPEVP
AIKGYIARFIERPAYKRALAKDAELAAAQAAPA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaccccacaaaaccgccaggtaaccctctatcactgcccttacacccgctccactggt
gccctgacgctgctggaagaactcggcgccgactacaagctccacgtgatgaacatgaag
ctcggcgagcagcgccaacctgagtttctcgctatcaaccccatgggcaaggtgcccacc
ctcacccatggcgacgcggtcgtgaccgagcaggtgtcagtctatctctaccttgccgac
ctctaccccgaagccaggctggcaccaccgctgggcgacccgttgcgcgggccttaccta
cgctggatggtgttctacggctcctgcttcgagccagccgtggtagaccgggtacagcag
cgcgagcccatccccgaggctcgctcgccctacggcgacttcgacagtgtgatgaaaacc
ctggtcgcgcaattgcagaaaggcccctggttgctgggtgaacagttcaccgccgccgac
gtgctctggggcagtgcgctgaactggaccacgcagttcgggctgatcccggaagtgccg
gcgatcaagggctacatcgcccgtttcatcgaacgcccggcctacaagcgagccctggcc
aaagacgccgaactggccgccgcccaggccgcaccggcctga

DBGET integrated database retrieval system