KEGG   Pseudomonas sp. TCU-HL1: THL1_4554Help
Entry
THL1_4554         CDS       T05373                                 

Definition
(GenBank) acetyl-CoA carboxylase subunit alpha
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
pset  Pseudomonas sp. TCU-HL1
Pathway
pset00061  Fatty acid biosynthesis
pset00620  Pyruvate metabolism
pset00640  Propanoate metabolism
pset01100  Metabolic pathways
pset01110  Biosynthesis of secondary metabolites
pset01120  Microbial metabolism in diverse environments
pset01130  Biosynthesis of antibiotics
pset01200  Carbon metabolism
pset01212  Fatty acid metabolism
Module
pset_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pset00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    THL1_4554
   00640 Propanoate metabolism
    THL1_4554
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    THL1_4554
Enzymes [BR:pset01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     THL1_4554
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     THL1_4554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACCA Carboxyl_trans MdcE baeRF_family3
Motif
Other DBs
NCBI-ProteinID: AOE87102
UniProt: A0A1B3EC38
LinkDB All DBs
Position
complement(4919797..4920747)
Genome map
AA seq 316 aa AA seqDB search
MNPNFLDFEQPIADLQAKIEELRLVGNDNALNITDEISRLQEKSSALTESIFGNLSSWQI
AQLARHPRRPYTLDYIEHIFTEFDELHGDRHFSDDAAIVGGVARLNDEPVMIIGHQKGRE
VREKVRRNFGMPRPEGYRKACRLMEMAERFKMPILTFIDTPGAYPGIDAEERGQSEAIAW
NLRVMARLKTPIIATVIGEGGSGGALAIGVCDRLNMLQYSTYSVISPEGCASILWKTAEK
APDAAEAMGITAERLKGLGIVDKVIAEPLGGAHRDPSATAESIRKELAEQLKSLQKLSSE
DLLARRYERLMSYGVA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgaactttctggatttcgaacagcccatcgccgatctgcaagccaagatcgag
gagctgcgtctggtcggtaacgacaacgccctgaacatcaccgacgagatttcccgtctg
caggagaagagcagcgcgctcaccgaaagcattttcggcaatctctccagctggcagatc
gctcaactggcgcgccatccgcgccggccctacaccctcgattacatcgagcacatcttc
accgagttcgacgagttgcatggcgaccgtcacttctcggatgacgcggcgatcgtcggc
ggcgtggcccgtctgaacgacgagccggtcatgatcatcggccaccagaaaggccgtgaa
gtgcgtgagaaggttcgccgcaatttcggcatgccgcgccccgagggctatcgcaaggcc
tgccgcctgatggaaatggccgagcgcttcaagatgccgatcctcaccttcatcgacacg
cccggtgcttatccgggcattgatgccgaggagcgcggccagagcgaggccatcgcctgg
aacctgcgtgtgatggcgcgcctgaagacgccgatcatcgctacagtgatcggtgaaggt
ggttccggcggcgcgctggccatcggcgtctgcgaccgtctgaacatgctgcagtactcc
acctattcggtgatctccccggaaggttgcgcttctattctgtggaaaaccgccgagaag
gcacccgacgcggccgaagccatgggcatcaccgccgagcgcctgaagggcctgggtatc
gtcgacaaggtgattgccgagcccttgggcggcgcccatcgcgacccgtcggccactgcc
gagtccatccgcaaggaactcgccgagcagctgaagtcgctgcagaagctcagcagcgag
gacctgctggcgcgtcgctatgagcgtctgatgagctacggcgtagcctga

DBGET integrated database retrieval system