KEGG   Pseudomonas sp. TCU-HL1: THL1_4587Help
Entry
THL1_4587         CDS       T05373                                 

Definition
(GenBank) gliding motility protein GldF
  KO
K01992  ABC-2 type transport system permease protein
Organism
pset  Pseudomonas sp. TCU-HL1
Brite
KEGG Orthology (KO) [BR:pset00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pset02000]
    THL1_4587
Transporters [BR:pset02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    THL1_4587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_2 ABC2_membrane_3 ABC2_membrane_5 ABC2_membrane_4 CcmB
Motif
Other DBs
NCBI-ProteinID: AOE87135
UniProt: A0A1B3EC60
LinkDB All DBs
Position
complement(4958522..4959256)
Genome map
AA seq 244 aa AA seqDB search
MKQLPVIFKRELASYFATPLAYVFIVIFLVLSGVFTFYLGGFYESGQASLAPFFNFHPWL
YLFLVPAIAMRLWAEERKSGSIELLMTLPITRFEAVTGKFLAAWAFAGLALLLTFPMVIT
VNYLGEPDNGAIITGYIGSWLLAGAFLAIGSCMSALAKNQVIAFILAVSVCFLFIVSGFP
LVLDAFSTWAPQWLLDAVASMSFLTRFDAISKGVIDLRDLLYFVTLIAAWLAATAVVVDL
KKAD
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagttgccggtgattttcaagcgcgaactggcgagttacttcgccactccgctg
gcgtacgtgttcatcgtgatcttcctggtgctgtccggggtcttcaccttctatctgggc
ggcttctacgaaagcggccaggcgagcctcgcgcccttcttcaacttccacccctggctg
tacctgttcctggtgccggccatcgccatgcgcctctgggccgaagagcgcaagtccggc
tccatcgagctgttgatgaccctgccgatcacccgcttcgaggcggtcaccggcaagttc
ctcgccgcctgggccttcgccgggctggcgctgctgctgaccttcccgatggtcatcacg
gtcaactacctgggcgagccggacaatggcgccatcatcaccggctacatcggcagctgg
ttgctggctggagccttccttgccattggctcctgcatgtcggcgctggcgaagaaccag
gtgatcgccttcatcctcgctgtcagcgtgtgcttcctgttcatcgtcagcggctttccg
ctggtgctggacgccttcagcacctgggcgccccaatggctgctggatgccgtggcctcg
atgagcttcctgacccgtttcgatgccatcagcaagggcgtgatcgacctgcgtgacctg
ctctacttcgtcaccctgatcgccgcctggctggctgccaccgctgtggtggtcgatctg
aaaaaggccgactga

DBGET integrated database retrieval system