KEGG   Pseudomonas sp. TCU-HL1: THL1_993Help
Entry
THL1_993          CDS       T05373                                 

Definition
(GenBank) histidine kinase
  KO
K02668  two-component system, NtrC family, sensor histidine kinase PilS [EC:2.7.13.3]
Organism
pset  Pseudomonas sp. TCU-HL1
Pathway
pset02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pset00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    THL1_993
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pset01001]
    THL1_993
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pset02022]
    THL1_993
   02035 Bacterial motility proteins [BR:pset02035]
    THL1_993
Enzymes [BR:pset01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     THL1_993
Protein kinases [BR:pset01001]
 Histidine kinases
  NtrC family
   THL1_993
Two-component system [BR:pset02022]
 NtrC family
  PilS-PilR (type 4 fimbriae synthesis)
   THL1_993
Bacterial motility proteins [BR:pset02035]
 Pilus system
  Twitching motility proteins
   THL1_993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PAS_8 PAS HATPase_c_3 HATPase_c_2 PAS_9 PAS_7
Motif
Other DBs
NCBI-ProteinID: AOE83541
UniProt: A0A1B3E1Y6
LinkDB All DBs
Position
complement(1071935..1073536)
Genome map
AA seq 533 aa AA seqDB search
MSADSLSLPSALSAQGRRIFRLYSLYRLLIGVALVVLISSELDDELLDLARPELFRNASW
FYLILNTLIAALVPRPRSMVQVFSLAVVDVLLLSCLFFAGGGTPSGIANLMVVSVAISNI
LLRGRIGLLVAAVATIGLIYLTFYLSLSHPQAASQFVQAGGFGALCFAAALFIQGLSRRL
QLSETLSEQRAADVANLEALNAQILERMRTGILVLDPRNQILLANNGAQTLLGKDNLMGR
PLDTQCRELLASLQQWLANPTLRPQSIQAFADGPTLQPSFVHLQRGNEKNTLVFLEDISQ
IAQQAQQLKLASLGRLTAGIAHEIRNPLGAISHAAQLLQESEELQGPDRRLAQIIQDHSR
RMNLVIENVLQLSRRRQSEPQLLDLKYWLTRFASEFRSTSGANQTLHLTTLGSTLQTRMD
PHQLTQVLTNLVQNGLRYSAKQHSQGQVWLKLFRDPESDLPVLEVEDDGEGVAPEQVHNI
FEPFFTTESKGTGLGLYISRELCESNQARLDYKPREPVGSCFRITFAHPRKLS
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgctgacagcctgtccctacccagtgcactcagcgcccagggacgccgcatcttc
cgcctgtacagcctgtaccggctgctgatcggcgttgcactggtggtactgatctccagc
gagctggatgacgaattactcgatctggcacgaccggaactgttccgcaacgccagctgg
ttctacctgatcctcaataccctgatcgccgcgctggtcccccgcccccgaagcatggtg
caggtattcagcctggcagtggtcgatgtgctgctgctgtcctgcctgttcttcgcggga
ggaggcacgcccagcggcatcgccaacctcatggtggtgtcggtggccatctccaacatc
ctgttgcggggccgcatcggattgctggtggcggctgtggcgaccatcgggctgatctac
ctgaccttctacctcagcctcagccatccgcaggctgccagccagttcgtccaggccggc
ggctttggtgcgctgtgttttgccgccgcgctgttcatccagggcctgagccgccgcctg
caactcagcgaaaccctctccgagcaacgcgccgccgatgtcgccaacctggaggcgctc
aacgcgcagattctcgaacgcatgcgcaccggcatcctggtgctcgacccgcggaaccag
atcctgctcgccaacaatggcgcccagacactgctgggcaaggacaacctgatgggccgg
ccactggacacccagtgccgcgaactgctggcaagccttcagcagtggctggccaacccg
accttacgcccccagagcatccaggcatttgccgacggcccgaccttgcagccgagcttc
gtccacctgcagcggggcaacgaaaagaacaccctggtgttcctcgaagacatctcccag
atcgcccagcaggcccagcaactcaagcttgcctccctgggccgcctgacggcgggcatc
gcccacgaaatccgcaaccccttgggcgccatcagccacgccgcccagctcttgcaggaa
tcggaagaactccagggccccgatagacgcctggcgcagatcatccaggatcactcgcgg
cgcatgaacctggtcatcgaaaacgtcctgcaactgtcccgccgccgccagtcggaaccg
caactgctggacctcaagtactggctgacccgcttcgccagcgagttccgcagcacctcc
ggcgccaaccagaccctgcacctgaccacccttggcagcaccctgcaaacccgcatggac
ccgcaccaactgacccaggtgctgaccaacctggtgcagaacggcctgcgctacagcgcc
aagcagcacagtcagggccaggtctggctcaagctgttccgcgacccggaaagcgacctg
ccagtgctggaggtcgaggacgatggcgaaggcgtagcgcccgagcaggtgcacaacatc
ttcgagcccttcttcaccacggagagcaagggcactggcctgggcctgtacatttcccgc
gaactctgcgaaagcaatcaggcgcgactcgactacaaaccgcgcgagccagttggcagc
tgcttccgcatcaccttcgcacacccgcgcaaactgagctga

DBGET integrated database retrieval system