KEGG   Pseudanabaena sp. PCC 7367: Pse7367_0024Help
Entry
Pse7367_0024      CDS       T02369                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
pseu00473  D-Alanine metabolism
pseu00550  Peptidoglycan biosynthesis
pseu01100  Metabolic pathways
pseu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pseu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Pse7367_0024
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Pse7367_0024
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Pse7367_0024
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pseu01011]
    Pse7367_0024
Enzymes [BR:pseu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Pse7367_0024
Peptidoglycan biosynthesis and degradation proteins [BR:pseu01011]
 Precursor biosynthesis
  Amino acid ligase
   Pse7367_0024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AFY68345
UniProt: K9SDW8
LinkDB All DBs
Position
complement(30351..31406)
Genome map
AA seq 351 aa AA seqDB search
MNSTNNQTLKIGLLFGGQSGEHEVSLVSAKSIAQGLGQNPRNQVMPFYIQKDGVWCDPER
SLNVLEAGKPEQIDNSGQFKLPAAANEVDVWFPALHGPNGEDGTVQGMLQLMQKPYVGNG
VLASAVGMDKVLMKALFAQAGLAQVKYVALSRWQWQQEPEEWYEHIETTLGYPCFVKPAN
LGSSVGISKVRDRSQLEAAIHSATSYDPRVIIEQGVTAREIECAVLGNEQPKASIVGEIT
YNSDFYDYETKYTPGMADLHIPAQLPETVTQAVQDMAIAAFEAVAGSGLGRVDFFYVEAS
SMVLINEINTLPGFTSTSMYPKLWEASGISFHDLCDRLVDLALERHKPIVG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaaccaacaatcaaaccctaaaaatcggcctcttatttggtggtcaatccggc
gagcatgaagtttcgctggtttccgccaagtcgatcgcccagggcttggggcagaatccc
cgcaatcaagtcatgcccttctatattcaaaaagacggggtgtggtgtgatccagagcga
tcgctaaacgtattagaagccggtaagccagagcagattgacaatagtggtcagtttaaa
ttacccgccgccgccaatgaagttgatgtgtggttcccggcgctgcatggccccaatggt
gaagatggcaccgtgcaggggatgctgcaactgatgcaaaagccctatgttggtaatggc
gtgttggcctcggcggtgggcatggacaaggttttgatgaaggcgttgtttgcccaggca
ggcttggcgcaggtcaaatatgtggcgctgagtcggtggcagtggcagcaggaaccggaa
gagtggtatgagcacattgaaactacgctgggttatccctgttttgttaaacctgccaac
cttggctcctcggtggggatttccaaggtacgcgatcgctcccagctagaggcagcgatc
cacagcgccaccagctatgaccccagggtcattattgagcagggcgttaccgccagggaa
attgaatgcgcggtgttggggaatgagcaacccaaagcctcgatcgtgggtgagattacc
tacaatagcgatttttacgactatgaaaccaaatatacgcctgggatggcggatttacat
attcctgcgcaattgccagagacagtgactcaggcagtgcaagacatggcgatcgccgca
tttgaagcagttgctggttcagggctggggcgcgtggactttttctatgtggaagcgagt
tctatggttttaattaatgagatcaataccctgcctggatttacctccaccagtatgtat
cccaaactgtgggaagcgagcggaattagttttcatgacctatgcgatcggttagtagat
ttagcgctagagagacataaaccgatcgttggttaa

DBGET integrated database retrieval system