KEGG   Pseudanabaena sp. PCC 7367: Pse7367_0916Help
Entry
Pse7367_0916      CDS       T02369                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
pseu00630  Glyoxylate and dicarboxylate metabolism
pseu00710  Carbon fixation in photosynthetic organisms
pseu01100  Metabolic pathways
pseu01120  Microbial metabolism in diverse environments
pseu01200  Carbon metabolism
Module
pseu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pseu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pseu_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pse7367_0916
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Pse7367_0916
Enzymes [BR:pseu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Pse7367_0916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFY69216
UniProt: K9SGW0
LinkDB All DBs
Position
complement(1183370..1183699)
Genome map
AA seq 109 aa AA seqDB search
MQVVSKERKFETLSYLPPLSDAQISKQIQYVIDQGFFPCVEFNETSNPEEYYWTMWKLPL
FNANSAQEVLSEVQACRSAFSNCYIRVVAFDNIRQCQVTSFIVHKPNRF
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtagtatcaaaagaacgtaagtttgaaactctgtcctatctgccccccctaagt
gatgcgcagatttctaagcagatccaatatgtgatcgaccagggcttcttcccctgtgtg
gaattcaacgaaacctctaatccagaagaatattactggacgatgtggaagttgcctttg
ttcaacgccaatagcgcccaagaagtgctcagcgaagtccaagcctgccgctctgctttc
tccaactgctacattcgcgttgtggcctttgacaacatcagacagtgccaggtgacatcc
tttattgttcataagcctaaccgtttctag

DBGET integrated database retrieval system