KEGG   Pseudanabaena sp. PCC 7367: Pse7367_2328Help
Entry
Pse7367_2328      CDS       T02369                                 

Definition
(GenBank) Peroxidase
Organism
pseu  Pseudanabaena sp. PCC 7367
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: An_peroxidase HemolysinCabind
Motif
Other DBs
NCBI-ProteinID: AFY70590
UniProt: K9SKE1
LinkDB All DBs
Position
complement(2937843..2940125)
Genome map
AA seq 760 aa AA seqDB search
MVMEDNLITRNPFAEDNFETRRFDGTGNNLTDIFRTVGAVGTRFRRIAPVEYENGINSPA
GIAPPGGSRRPLPDGTIPGDRPSARLISNVLADQAGQSITNDRLMSDMIWGVGQFLNHDT
DLALSDNEAIANGLIAQGIPQDFPIPIPADDPVFGPNGTNPMPGGVLRFERDVFAPETGT
IINGVPGEAINTVTAWLDLSTVYGSEPLLARNLSQLSDGMLRTFATDSGALLPPDFDGVT
SGGAFMGVGFMAGDSRVNENSSLVAQHTLWVRNHNRLAGLLAATHPDWDNAKLFERSRQI
NIAQWQNIVLYEWLPALIGNSFVPEYGGYDPNLDPQTTNTFAVAALRIGHTLVSPQILRL
DQNFEPLPEGEIAFIENFGAPDIITGENVDQVLRGLASGIAQEVALNVIDDLRNGLPVSG
PVGFDLLAANIQRGRDRGLADYNELRRNLSIVVPELGIRPVSSFAEITSDPDLQRSLEEL
YGSVDDIDMWVGLMAEDHLPGASVGLTEQAVLGFQYMAMRGGDRFWFENPIETGGSFTAA
EIAEIRNLRLSDIIELNTNTTGLRQNVFFTIDTQFQSGNDTDEFFTGIEGNDFLRGLGGN
DTLQGNQGDDVLSGNRGFDLLIGDAGNDSLFGGANHDFLVGGVGSDLLSGDRGNDTISAV
NFDGSNIPEFDFLIGGAGSDLFILGDRGNSNIIVLANSATIGDFTAGEDLIQLVNGTGAY
QIEAIADGGIGIFSNGALIAALPNLTLADVGAVTAALLLV
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggtaatggaagacaatttaatcacccgtaatccatttgcggaagacaactttgaaact
cgcagatttgatgggactggcaataacctcaccgatatttttcgcaccgtgggtgcagtg
ggcacgcgttttcggcggattgccccagtcgagtatgaaaatgggatcaactcccccgct
ggcattgctccaccaggtggcagccgcagacccttaccagatgggactattcctggcgat
cgccccagtgccaggttaattagcaatgtgctcgccgatcaagctggtcaatcaattact
aacgatcggttgatgagtgacatgatctggggggtgggacagtttttaaaccatgatact
gacttagccctatcagacaacgaagcgatcgccaatggtctgattgcccagggcatcccc
caggactttccgattccaatcccagcagacgacccagtgtttggccccaatggcactaat
ccaatgcccggtggtgtgctgcgctttgaacgtgacgtttttgcgccagaaacaggcacg
atcattaatggcgtaccaggcgaggcgatcaatacggttacagcctggctcgatctttcc
accgtttatggctctgaaccacttctggccagaaatctcagccaactaagcgatggcatg
ttgcgtacctttgccactgacagtggtgctctgttgccaccggattttgacggggtgacc
agtggcggtgcatttatgggcgtgggctttatggctggagattcacgcgtcaatgaaaat
agcagtctggtggctcaacataccctgtgggtgcgaaatcacaatcgcctggcgggatta
ttagcggcaacacacccagactgggataatgccaaactttttgagcgatcgcggcagatc
aatattgcccaatggcaaaatatcgtgctctatgaatggctgccagccctgattggtaat
agtttcgtgccggaatatggcggctatgatcctaacctcgatcctcagactactaacacc
tttgccgtggcggcattgcggatcggccataccttggtgagtccccaaattctacgcctc
gatcaaaactttgaaccgttgccagagggtgaaattgcgtttattgaaaactttggcgca
ccggatattattacgggcgaaaatgttgaccaggttttgcgcggtctggccagtggcatc
gctcaggaagttgctcttaatgtgattgatgatctgcgcaatggcttgcccgtttctgga
ccagttggttttgatctgctggccgcaaatattcaacgtggccgcgatcggggtttggca
gactataacgaactgcgtcgcaatttaagcatcgttgtgcctgaattgggcattcggcca
gtgagcagctttgctgagattacatctgaccctgatttgcaacggagcctagaggagctt
tatggcagtgtcgatgacattgatatgtgggtggggctaatggccgaagatcacctgccc
ggagctagcgttggtcttactgaacaagcggttctggggtttcaatatatggctatgcgc
ggtggcgatcgcttctggtttgaaaacccgatcgaaaccggtggctcttttaccgctgcc
gaaattgccgagattcgcaatctacgcctgtccgacattattgaattaaataccaacacc
actggcctgcgtcagaatgtgttttttacgatcgatactcagttccaatctggcaatgat
acggatgagtttttcactgggattgagggcaacgacttcctgcgtggtctgggtggtaat
gatacgcttcagggcaatcaaggcgatgatgtgctgtcgggcaatcgcggttttgatctc
ttaattggtgatgcgggtaatgatagcctgtttggtggtgcgaatcatgattttctagtt
ggtggcgttggcagcgatttgcttagcggcgatcggggcaacgatacaatcagcgctgtt
aattttgatggtagtaacataccagaatttgatttcctgattggtggtgcaggcagtgat
ctatttatcctgggcgatcgtggcaatagtaatattatcgttcttgctaattctgcaacg
atcggcgatttcaccgcaggagaagatctaattcaattagtcaatggtactggcgcttac
cagattgaagcgatcgctgatggtgggatcggcatttttagtaatggcgctctgatcgcg
gcgctaccgaacttaacccttgcggatgttggagccgttacagcagccctgttattggtt
tag

DBGET integrated database retrieval system