KEGG   Pseudanabaena sp. PCC 7367: Pse7367_2813Help
Entry
Pse7367_2813      CDS       T02369                                 

Definition
(GenBank) Manganese/iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pseu  Pseudanabaena sp. PCC 7367
Brite
Enzymes [BR:pseu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Pse7367_2813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Phage_portal
Motif
Other DBs
NCBI-ProteinID: AFY71066
UniProt: K9SM60
LinkDB All DBs
Position
3547029..3547628
Genome map
AA seq 199 aa AA seqDB search
MAYQLPALPYDYTALEPAISKTTLEFHHDKHHASYVSKYNAAVEGTDFDKMAIEDVIKSI
AGDPSKSGLFNNAAQAWNHSFYWNSMKPGGGGMPTGALASKLNADFGSYDKFVEAFKAAG
GGQFGSGWAWLVVDGGTLKVTKTGNAENPLHLGQTPLLTMDVWEHAYYLDYQNKRPDYIA
EFLGKLVNWDFAAANFAAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcttaccaattacccgcacttccctacgattacactgccttggaaccagcaatttct
aagactacgttggaatttcaccatgacaagcaccatgctagctatgttagcaagtacaac
gctgcggtagaaggaactgattttgacaagatggcgatcgaagatgtgatcaagtcgatc
gctggtgatccttctaagagcggtttgtttaacaatgctgcccaagcctggaatcattcc
ttctattggaattcgatgaagcccggtggtggcggtatgcccactggcgctttggctagt
aagctcaatgctgactttggtagctatgacaagtttgttgaagctttcaaggctgctggt
ggtggtcagtttggtagcggttgggcttggcttgtagttgatggtggcaccttgaaggta
accaaaactggcaacgctgaaaatcccttgcatctaggacaaaccccattgctaactatg
gatgtgtgggaacatgcctactatcttgactatcaaaacaagcgtcctgactatattgcc
gaatttctgggcaagttagttaactgggactttgctgctgctaactttgccgctgcttag

DBGET integrated database retrieval system