KEGG   Pseudanabaena sp. PCC 7367: Pse7367_3072Help
Entry
Pse7367_3072      CDS       T02369                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
pseu  Pseudanabaena sp. PCC 7367
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH LAMTOR5
Motif
Other DBs
NCBI-ProteinID: AFY71321
UniProt: K9SMZ1
LinkDB All DBs
Position
complement(3845143..3847224)
Genome map
AA seq 693 aa AA seqDB search
MPKVPNAYSLPTSRYRTLGLVGRGQFGRVFCARSRKTGEIFALKELDQHRFPTSKFLREL
RFLLTLQHPNIVSCYAIEHSRGNRYLVMEYCEAGTLRDLLNHSGGLTPLQGLKLIIDTLQ
GLAHAHQSNIIHCDLKPENVLLKLTSKGWQAKVSDFGVAKLAQEIDNEGNNNTGSPGYMA
PERFYGQFSIASDLYAIGVMLYEVLLGKRPFSGNPAELMRAHINQRVQIPDTLPIALRDV
VAKSLEKLPRKRFNSALAMKEAIVAALKSDQVSKANLSQVLAFAAIDQLDVEVLPANYPA
PIDLDKLDKQDQQKERQGDRVFKRDLPAHVTELVVLGTTPKPILPNPNEHDLPITVASVA
ICGVVDGQLRLEQVELNGDPNAGIAGIKVAIASLANQLRDRSLAPSLTFEQAIENLSIWG
DRLFIFTGDSVYGLPANPESTSRKSQLLHRAAELQPNQPCLKAVSPRADWVALAQGSRLE
LKNLSNDRAFSLNFAKATANVQISAITAFDRHHLVVLLQQDNCEFSQIALVSRRGNLLWR
YPLPNRISAAVANCTNGRLILLEAKTNHLGLVELFPYRVNRLRLDYAPMAIAPTDWGCII
ATDLGNGQSNLNLLDLSGHRVGRLTVRGQVLKISLLNMHTLLVLTNANEANQADPNNTER
TDPSDRSDPLEQRDRHSSVYLIDLKQLEVDIIF
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagtccccaacgcctattcattgccaacttctcgatatcgcaccctgggttta
gtggggcgaggtcaatttgggcgggttttttgtgctcgcagccgcaagaccggagagatc
tttgccctcaaagagctagatcagcatcgcttccccaccagtaagtttttgcgagaacta
cgctttttgcttactctgcaacatccgaatatcgtttcttgctatgcgatcgagcacagt
cgcggcaatcgctacctggtgatggaatattgcgaagcaggcacattgcgggatttgctc
aaccacagtggtggcctgactccgttgcaggggcttaaattaatcattgatactttgcaa
ggtctggcccatgcccatcagagtaatattattcactgcgatctcaagccagagaatgta
ttgcttaagttaaccagtaaaggttggcaggctaaggtctctgattttggcgtggccaag
ttagcccaggaaattgataatgaggggaataataataccggctcaccggggtatatggct
ccagagcgcttttatggacaattttcgatcgcctcggatctctatgcgatcggcgtgatg
ttgtatgaggtgttgctgggcaagcggcctttttctggcaatccggcggagttgatgcga
gcgcatattaaccagcgggtgcagattcccgatacgctgccgatcgctttgcgggatgtg
gtagccaagtctctcgaaaagctaccgagaaaacgttttaatagtgccctggcgatgaag
gaggcaattgtagcggcgctgaaatcagaccaagttagtaaagccaacctatcgcaagta
ttggcatttgccgcgatcgatcaacttgatgttgaagttttgccagctaattatccagcg
ccgatcgatctagataaactagataaacaagatcagcaaaaggagcgtcagggcgatcgt
gtattcaagcgagatctaccagcccatgtaactgaattggtggttttgggaactacacct
aagccaattttgcccaacccaaatgaacatgatttgcctatcacagttgcatcggttgct
atttgtggcgtagtagatgggcaacttcggttggagcaagtcgagcttaatggtgatccc
aatgcaggtattgcaggtattaaagtagcgatcgctagtctggcgaatcaattgcgcgat
cgctcccttgccccgtctcttacttttgagcaagcgatcgaaaatttaagcatttggggc
gatcgtttatttatatttactggtgattcggtttatgggctgcctgcaaatcccgaatcg
accagccgcaaatcacaactacttcatcgagctgccgaactacagccaaatcaaccttgc
ttaaaagcagtttcaccccgcgcagattgggtggcattagcgcaggggagcaggttagag
ctaaagaatctgagcaacgatcgtgcctttagcctcaactttgccaaagccacggcgaat
gtccagatcagtgcaatcaccgccttcgatcgccaccacctggtagttttgctccagcag
gataattgtgaattcagccagattgccctagtgtcaagacgtggcaacctattgtggcgc
tacccactacccaaccgcatttctgcggcggtcgccaactgcaccaatggcagattgatt
ttattagaagcaaaaactaatcacctgggcttggtggagctattcccctatcgagttaat
cgtctgcgtttggactatgcaccgatggcgatcgcacctaccgattggggttgcattatt
gctactgatctgggcaatggccagagtaatttgaacctgctggatttatctggtcatcgg
gtggggcggttgacggtgagggggcaggtattgaaaatcagcttgctgaatatgcatact
ttgctagttctaactaatgctaatgaagctaatcaggctgatccaaataataccgagcgt
accgatccgtccgatcggtcagatccattagagcagcgcgatcgccatagttctgtttat
ttaattgacctcaagcagcttgaagtcgatattattttttaa

DBGET integrated database retrieval system