KEGG   Allopseudarcicella aquatilis: HME7025_00105Help
Entry
HME7025_00105     CDS       T05454                                 

Definition
(GenBank) hypothetical protein
Organism
psez  Allopseudarcicella aquatilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1707
Motif
Other DBs
NCBI-ProteinID: AWL07990
UniProt: A0A2S2DSG6
LinkDB All DBs
Position
97709..101437
Genome map
AA seq 1242 aa AA seqDB search
MSYTEEGRIKLIVDDVQASVKWEQNKQSISRIKKELEDLATSGAKGSEGYKKLQQELNGL
NNEQRSLKMNIDVSSASVNQLQEALRYWTSQAKQAKQGSSEWVAATSKIAEIRPHLTQAT
TELNSLGNVVKAQPSIWANFKTVALGVFAGQGLIGLVQGAITGLKSFGMSIYDMTAKFEK
YETVLRTVLGSQKLATEAMAMLKKFASETPFSLDQLTGSYIKLVQRGIKVTAVELTKLGD
LASSQGKEFDMLTEALLDAGTGEFERLKEFGIKGKTMGDQITLTFGKVQKVIANTPEAIQ
NAVISFGELNGVMGGMANISKDLAGKQSNLGDTFDDLRVRIGNKLKPVFHWFLDALYQSI
GLVVSLGRVVLEGGRFIAEVSPAIAGFAVAILTMNAANIKAAASALYHTTIEKGRAVYIA
LSASAMRAFNLVMAATPLGAIGLLIASAAAALVYFYNKSESAQAAVRGLWNALKAIGTTI
VTVIKAIASLDFSSVASAFSNAGKNIGAAYEKGYNEKTAEFAKSRRDKELAAQKAHLMQL
EDNKVAAIKNEDQREKARMDLAYKRKVEEINSTIKDATVRDQKLAQLATQHEGEISNIGR
AAREKRKQEQEEAAKKFKEAEKERLKDEEELLKQIGNAKIEAIKDDNERQLAKLKLDFER
DKDAVEKSKANAQIKAEALKQLQLAYDTSLLNMQEDFQKKKEKIELDAIKKKEAEDKKKA
DEEKARLDQERKDHKELLDDKFKAEIDQAKINLDLTKKNSQAMWDAKLRILNIEAKQKAD
RLKAEAKAERDRIKESLDAQTEKFRKEADLEKQRIAESVTDKTARDQQIKKIDDDTQLAI
FNSNTTAALRLKALDDRLVNELRLNDTSLQRDKINLNQEANDAKEQSNQEFYQGLNAAMA
GDMQSFLGFLKKKALEDGKHLNERTQAFANHANGVGSLMLNAVNQLMQLNANYTKSQLNN
LTSERDANLKKLDEEYEAGVLTKDELDTAKLKLQKKFDEEALKLKKEEFERNKKLQKANA
VIAGSMAILSALAMPWPVGLVMAVLAGVKTAYEINQISDQKFEGRKGGIFKNYGVAQGSS
HGKKYGEAGIVMHDRVTGAEVGEIEGGEPVMVLSKKTYANNKPVIDRLLESSMYRNGSPI
TMQDGGVFQLGRTKMMFADGGVFSRPTGVMPSESSESYINENKELQIEANRFLSGIYKHI
IELLSTNQAQKGILEDIREKDNASDIMHAIERRQSTTIKSRF
NT seq 3729 nt NT seq  +upstreamnt  +downstreamnt
atgagctatacagaagaaggaagaattaaactgatagtagatgatgtacaagcttcagta
aagtgggagcaaaataagcaatctatttcccgaataaagaaagagctggaggacctagcc
acttcaggagcgaaggggagcgaaggatataagaaattacagcaagagcttaatggattg
aataatgagcagcgttcactaaaaatgaacattgatgtttcttctgccagtgttaatcaa
ttacaagaggccttaaggtattggaccagtcaagctaaacaagcaaaacagggatcaagt
gaatgggtagcagcgacatctaaaatagcagaaattaggcctcaccttactcaagctact
actgagctaaattcattaggtaatgtagtcaaagcccagccttctatttgggcaaatttc
aaaacagttgcattaggagtctttgccggtcaaggtctaattggattagttcagggggcc
attactggattaaagagctttggtatgtcaatctatgatatgacagccaaatttgagaag
tatgagactgtacttagaacagtattgggtagtcaaaagctggctactgaagctatggcc
atgctaaagaagtttgcttcagaaactccattttctttagaccagttgacaggtagttac
atcaagctagtccagcgaggcatcaaagttactgcagtagaattgactaaacttggagat
ttagcctcatcccagggcaaagagtttgacatgctaacagaagcattattggatgccggt
actggagaatttgagcgattaaaagagtttggtatcaaagggaagaccatgggggaccaa
atcacattaacctttggtaaggttcaaaaagtgattgcaaatactcctgaagctattcag
aatgcagtaatatcctttggtgaattaaatggtgtcatgggaggcatggctaatatctct
aaagatttagctggaaaacaaagtaacctgggagatacttttgatgatttgagagtccgg
atagggaataaattaaaaccagtatttcattggtttttagatgcattatatcagtcaatt
ggccttgtagtctctctaggtagagtcgttcttgaaggaggaagatttatagctgaggtt
agcccggctatagcaggatttgctgtggctattttaaccatgaatgcagctaatattaag
gctgctgccagtgctttatatcatacgactatagaaaaaggaagggctgtttatattgcc
ctttctgcgtcagctatgagggcatttaatcttgttatggctgcgactccactgggggcc
attggacttttaattgcaagtgctgcagctgcactagtttatttttataataaatctgaa
tcagcacaagctgcagtaagagggctttggaatgcattgaaagcgataggaaccactatt
gttactgttattaaggcaattgcttccctagatttttctagtgtagcttcagctttttct
aatgccggtaaaaacattggagcagcttatgaaaaaggctataatgaaaagactgctgaa
tttgccaaatctagaagagataaagagctagctgctcaaaaggctcatttaatgcagtta
gaagataataaagtcgctgccattaaaaatgaggatcaaagggaaaaggcccggatggat
ttagcctacaagcgaaaagtagaagaaatcaattctaccatcaaagatgccacagtaaga
gatcaaaaattagcccagctggccactcagcatgagggggaaatttccaatattggaaga
gcagccagggaaaaacgtaagcaggagcaggaagaagcagccaaaaaatttaaggaggct
gaaaaagaacgcttaaaggatgaggaggagctattaaagcagattggaaatgctaaaatt
gaagctataaaagatgataatgagcgtcaattagccaaactaaagctagattttgagcgt
gataaggatgctgtagaaaagtctaaagccaatgctcaaataaaagctgaagcattaaag
caactgcagttagcttatgatacaagtcttctaaatatgcaggaggatttccagaagaag
aaagaaaagattgagcttgatgccattaagaaaaaagaagctgaagataaaaagaaagct
gatgaagaaaaggctcgattagaccaggagagaaaggaccataaggagcttttagatgat
aagttcaaggccgaaattgatcaggctaaaattaatctagatctcactaagaaaaattcc
caggctatgtgggatgctaagcttaggattttaaatattgaggcaaagcaaaaagctgat
agactaaaagctgaagcaaaggctgagagggatagaattaaggaaagccttgatgctcaa
acagaaaaattccgcaaagaggctgatttagaaaaacaaagaattgctgaaagtgttact
gataaaacagctagagatcagcaaatcaagaaaatagatgatgatactcagcttgctatc
tttaattcgaatactactgcagcattaaggctaaaagccctagatgatagattagtcaat
gagcttcgattaaatgatacttcgcttcagcgagacaagatcaatttaaatcaagaggcg
aacgatgctaaagaacaaagtaatcaagagttttaccagggattaaatgctgccatggct
ggggacatgcagtcattcttgggatttttgaagaaaaaggcattagaggatggtaagcat
ttaaatgaaaggactcaggcctttgctaatcatgccaatggtgtgggttcattaatgctc
aatgctgtaaatcagcttatgcaattgaatgccaattataccaaatcccagctaaataat
ttgacttctgaaagggatgctaatttgaagaaattagatgaagagtatgaagctggagta
ttaacaaaggatgaacttgatactgctaagctaaagcttcagaagaaatttgatgaggaa
gcattaaagcttaagaaggaggaatttgaacgaaataaaaagcttcaaaaagctaatgca
gttatagccggatcaatggctattttaagtgctctagctatgccatggccagtaggttta
gtaatggctgttttagctggtgttaaaactgcttatgaaataaaccagatttcagaccaa
aaatttgaggggagaaaaggaggtatattcaaaaattatggagtagcccaaggttcatcc
catggtaagaaatatggtgaagctggaatagtgatgcatgaccgagttaccggtgctgag
gtaggagagattgaagggggagagcctgtaatggttctttctaaaaagacctacgcaaat
aataagcccgtaattgatagactcttggaaagttcaatgtacagaaatggttcaccgatt
accatgcaagatggtggggtatttcaactaggacgaactaagatgatgtttgcagatggc
ggggtattttcaaggcccacaggagtgatgccgagtgaaagcagtgaatcctatatcaat
gagaataaagagcttcaaatcgaagcaaatcgattcttatctgggatttataaacacatc
attgaacttcttagtacaaatcaagctcaaaagggaattttggaggatatccgggaaaaa
gataatgcatctgatataatgcatgccattgaacgtagacagtcgacaactattaaaagc
cgtttctaa

DBGET integrated database retrieval system