KEGG   Pseudovibrio sp. FO-BEG1: PSE_0274Help
Entry
PSE_0274          CDS       T01669                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:psf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PSE_0274
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psf02000]
    PSE_0274
Enzymes [BR:psf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PSE_0274
Transporters [BR:psf02000]
 Other Transporters
  Pores ion channels [TC:1]
   PSE_0274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 Tom37 GST_C GST_N_4 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AEV34786
UniProt: G8PIJ7
LinkDB All DBs
Position
268918..269520
Genome map
AA seq 200 aa AA seqDB search
MYKVIGHPQSRTMRVLWLLEELDLPYEVVPSKPHHENVYAVNPSGKIPALIVGDETIYDS
TAICTYLADKHSGLSFPAGTLERAQQDSFTNFALDEMDSILWMAAKHSFIHPEDQRVPDI
KPACRFEWARSMKHLEARLKGKTWAMGDTFTISDIIIGHCAFWAKVSKFEWPEGPVSDYF
SRVLARPALAKANEKALAQL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaagttattggacacccgcaatcaagaaccatgcgggttttatggctcttggaa
gaactggatctgccttacgaggtcgttccaagtaaaccgcaccatgaaaatgtttatgcc
gtaaatccttcaggcaaaattcctgccctgatcgtcggcgatgaaaccatttacgattca
acagccatctgcacatatctggcagacaaacattcaggcctttccttcccagctggaact
ctggaacgcgcccagcaagacagtttcacaaactttgcactggatgagatggattcaatc
ctctggatggctgcaaaacactcattcattcacccggaagatcagcgcgtccccgacatc
aaaccagcctgtcgtttcgagtgggcaagatcgatgaagcatcttgaagcccgtttgaaa
ggtaagacatgggcgatgggagacaccttcaccatttccgacatcatcatcggacactgc
gcattctgggccaaagtttccaagtttgagtggccagaaggcccagtaagcgactatttc
tcaagagttttggcgcgaccagctctggcaaaagctaatgaaaaagcccttgctcaactc
tga

DBGET integrated database retrieval system