KEGG   Pseudovibrio sp. FO-BEG1: PSE_0360Help
Entry
PSE_0360          CDS       T01669                                 

Definition
(GenBank) angiotensin I converting enzyme isoform 2
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
psf  Pseudovibrio sp. FO-BEG1
Brite
Enzymes [BR:psf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     PSE_0360
Peptidases [BR:psf01002]
 Metallo Peptidases
  Family M2
   PSE_0360
Exosome [BR:psf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSE_0360
CD molecules [BR:psf04090]
 Proteins
  PSE_0360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AEV34872
UniProt: G8PJG6
LinkDB All DBs
Position
complement(358330..360120)
Genome map
AA seq 596 aa AA seqDB search
MLPALSLALIPLSAAQAEGEKAVTVEDAKAFIESSEKAIQEIGEEAGRIAWVNANFITYD
TNWLNALMSERTTKLYVSLANQTKQFDGLALPPDLARKMKLLKLNLTLPAPENDPAKIKK
LAQINTEMETIYGTGKYEIDGEALSLSKLSRIMATSRDYDKLLEVWKGWRTVSPPMKDMY
AEMVGIANQGSSELGFKDTGSMWRSKYDMDPDDFRQDVDRLWGEVKPLYDSLHCYVRGKL
VDHYGADKVPADGPIPAHLLGNMWAQSWGNIYPLVAAEGDDQGYDLTKLLEEQNYTPLKM
VQTAEGFFTSLGFDPLPETFYERSLITEPRDRDVQCHASAWNVDGKEDLRIKMCTEVTGE
DFNTVHHELGHNFYQRAYNHQSPMYQDDPNDGFHEAIGDMVSLSITPKYLKQIGLLPLDA
SEEVNTNILMAQALDKIAFLPFGLLVDQWRWKVFNGELTPDTYNEGWWELREKYQGVAAP
VERAADAFDPGAKYHIPNNVPYTRYFLAHIFQFQFYREACRIAGWEGPLAACSIYGNKEV
GKKFNAMLETGSALPWQDSLEAFTGSREADATAILEYFAPLKAYLDEQNKGKSCGW
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcccgcactttcgcttgcgctcattccattgagtgcggcacaggctgagggagag
aaggccgttacggttgaggatgcgaaagcattcatcgagtcttcagaaaaagccattcag
gagattggagaggaagctggccgcattgcgtgggtgaatgccaacttcatcacttatgac
accaactggctgaacgctttgatgtctgagcggaccacgaaactttacgtttcactcgcc
aaccagacaaagcagtttgatgggcttgctcttccgccagaccttgcccgcaagatgaag
cttttgaagctgaatctgacactgcctgcgcctgaaaacgaccctgccaagatcaagaag
cttgctcagatcaataccgagatggaaaccatctatggcaccggcaagtatgagattgat
ggtgaggcgctgtctctttccaagttgagccgcatcatggcaaccagccgtgattacgac
aaactgctggaggtctggaaaggctggcgcactgtttctccgcccatgaaggacatgtat
gcggagatggttggcatcgccaatcagggttctagcgagcttggcttcaaagacaccggc
tctatgtggcggtccaaatacgatatggatccagatgatttccggcaggatgttgatcgc
ctgtggggtgaggtgaagccgctttacgacagccttcattgttatgtgcgcggcaagctg
gtggatcattacggtgccgataaagtgcctgcggatgggccaatccctgcgcatctgctg
ggtaatatgtgggcgcaatcctggggcaacatctatccgctggttgcggcggaaggggac
gatcaggggtatgacctgaccaaacttctggaagagcagaactatacgccgctgaagatg
gtgcagacggcagaaggattcttcacctcacttggctttgatccgctgcctgagacattt
tacgagcgctccttgatcaccgagccgcgtgatcgggatgtgcagtgccatgcatccgcc
tggaacgtggatggtaaagaagacctgcgcatcaagatgtgcactgaggtgacgggagag
gacttcaacaccgttcaccatgagctggggcacaacttctaccagcgtgcctataaccac
cagtcgcccatgtatcaggatgacccgaatgacgggttccatgaagcaattggtgatatg
gtgagcctttccatcacgcctaagtatctgaaacagatcggccttctgcctctggatgct
tcagaggaggtgaacaccaacattctgatggcgcaggcgctggataagatcgcgtttctt
ccgtttggcctgctggtggatcagtggcgctggaaggtgttcaacggtgagctgacacca
gacacctacaatgagggttggtgggagcttcgtgagaaatatcaaggtgttgctgcaccg
gttgagcgtgcggcggatgcgtttgatccgggtgccaagtaccacattccaaacaatgtg
ccgtacacccgttatttcctcgcgcatatcttccagttccagttctaccgtgaggcctgc
cgcattgccgggtgggaagggccgctggcggcctgttccatctatggcaacaaggaagtt
ggcaagaaattcaatgcgatgctggaaacgggctccgctctgccgtggcaggacagtctg
gaagccttcaccggtagccgtgaggccgatgcgaccgctattcttgagtattttgctccg
ctcaaagcctatctggatgagcagaacaaaggcaaatcctgcggctggtag

DBGET integrated database retrieval system