KEGG   Pseudovibrio sp. FO-BEG1: PSE_1619Help
Entry
PSE_1619          CDS       T01669                                 

Definition
(GenBank) phage SPO1 DNA polymerase-related protein
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:psf00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    PSE_1619
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:psf03400]
    PSE_1619
Enzymes [BR:psf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     PSE_1619
DNA repair and recombination proteins [BR:psf03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     PSE_1619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AEV36131
UniProt: G8PSM5
LinkDB All DBs
Position
complement(1712818..1713819)
Genome map
AA seq 333 aa AA seqDB search
MAMSEVPVANAAELEAYLEFLSAVGVDCAMEDAPIDRFAQTQAQMEKQAQARPAPQQNFA
PANSFASPEPTQSQPKNLSVSPAEMARNLRENGVSADDKMKARQILERQRAAKESAVQTV
MPNAADNAVVPNAETVGSARSAASSAQSLDELRKILAGFEGCNLRLTAKNLVFGDGSSKA
RVMFVGEAPGREEDIQGVPFVGRSGHLLDRMLKAVGLDRSNVYIANVVPWRPPGNRTPTP
HETEICRPFIQRQIELVDPEIVVFLGAASAKTLSGARDGIRKLRGKWLTYNGEGTQRKAI
ATYHPAYLLRSPAEKRYAWRDMLQIRAELETTE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggctatgtctgaagttcctgtcgcaaatgccgccgagctggaggcttatctggagttc
ctgagtgctgtcggtgtcgactgcgcgatggaagatgctccgattgatcgctttgcgcaa
acgcaggctcagatggagaaacaggcacaggcacgcccggctccgcagcagaactttgca
ccggccaactcctttgcttcaccagagccaacccagtcccagccgaagaaccttagcgtt
tctcctgctgagatggcacgtaatctgcgtgaaaacggcgtttcggctgatgacaagatg
aaagcaaggcagattttggagcggcagcgggcggccaaagagtctgccgtgcagaccgtc
atgccaaatgctgctgacaatgctgttgttcccaatgcagaaaccgttggttctgccaga
agtgctgcgagctctgctcagtcgctggatgagttgcgtaagatccttgccggttttgag
ggctgcaatctgcgcctgaccgccaagaacctcgtgtttggtgatggcagttccaaggcc
cgcgttatgtttgttggcgaagcaccggggcgtgaagaggatattcagggcgttccattt
gttgggcgttccggccatctgctggaccgtatgctcaaggctgtcggacttgatcgctcc
aacgtttatattgccaacgttgttccatggcgccctccagggaaccgcacccctactccg
catgaaaccgagatctgccgtccgtttattcagcgacagattgaactggttgatcctgaa
atcgtggtgttcctgggagcagcctcggccaagacgctgagcggtgcccgtgacggcatt
cgcaagctgcgcggtaagtggctgacttataacggtgaaggcactcagcggaaggctatt
gcaacctaccaccctgcctatctgctgcgcagcccagcggaaaaacgctatgcatggcgg
gacatgctccagattcgtgctgagcttgaaacaaccgagtaa

DBGET integrated database retrieval system